Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Parachlorella kessleri ADP, ATP carrier protein

This Recombinant Parachlorella kessleri ADP, ATP carrier protein spans the amino acid sequence from region 1-339.

Product Specifications

Product Name Alternative

ADP, ATP carrier protein, ADP/ATP translocase, Adenine nucleotide translocator, ANT

UniProt

P31692

Expression Region

1-339

Origin

Parachlorella kessleri (Green alga) (Chlorella kessleri)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSSALYQQAGLSGLLRASAMGPQTPFIASPKETQADPMAFVKDLLAGGTAGAISKTAVA PIERVKLLLQTQDSNPMIKSGQVPRYTGIVNCFVRVSSEQGVASFWRGNLANVVRYFPTQ AFNFAFKDTIKGLFPKYSPKTDFWRFFVVNLASGGLAGAGSLLIVYPLDFARTRLAADVG SGKSREFTGLVDCLSKVVKRGGPMALYQGFGVSVQGIIVYRGAYFGLYDTAKGVLFKDER TANFFAKWAVAQAVTAGAGVLSYPFDTVRRRLMMQSGGERQYNGTIDCWRKVAQQEGMKA FFKGAWSNVLRGAGGAFVLVLYDEIKKFINPNAVSSASE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRCA1 (NM_007294) Human Mutant ORF Clone
RC403147 10 µg

BRCA1 (NM_007294) Human Mutant ORF Clone

Sign In for Pricing
View Details
Stat6 discontinued
542675-01 30ul

Stat6 discontinued

Sign In for Pricing
View Details
Stat6 discontinued
542675-02 100 µL

Stat6 discontinued

Sign In for Pricing
View Details
Human Monoclonal IL-5R alpha/CD125 Antibody (benralizumab) [HRP]
NBP3-28011H 0.1 mL

Human Monoclonal IL-5R alpha/CD125 Antibody (benralizumab) [HRP]

Sign In for Pricing
View Details
C19orf35 siRNA (Human)
MBS8223086-01 15 nmol

C19orf35 siRNA (Human)

Sign In for Pricing
View Details
C19orf35 siRNA (Human)
MBS8223086-02 30 nmol

C19orf35 siRNA (Human)

Sign In for Pricing
View Details