Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class alpha-18 (sra-18)

This Recombinant Serpentine receptor class alpha-18 (sra-18) spans the amino acid sequence from region 1-340.

Product Specifications

Product Name Alternative

Serpentine receptor class alpha-18, Protein sra-18

UniProt

O18689

Expression Region

1-340

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKTAEELDSRNCASESLTNALISITMKFNFIFIITVVLISYCFTWLAIQALWKHNIFSN STRLILIVCLLNSVVHQTTMLETRITQAYRSVVYDSEPCKLLFRSSDCVFELYLYYPTGY FSTYSVFSLTFDRLISHYKSRYYHMHQYFIATSLLVLQLLLTMFSFYIVFYGVSLAGYVP MCNFRPELTVYYGAINNVRTGVMVSCIIVTMFVYYVCVKSEKQIQKCSYSPGERYSAYEN VTTSQSICISIVLQFSCIMISSFGSNLLIHITSKTTVSEEVFYAIVSFLPGVTYANLCLP LVIYFKTKLTTRNRKNRIAVMTSMYGDAGEHIDRLKRSWE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCM7 (Proliferation Marker) (rMCM7/1468), CF740 conjugate, 0.1mg/mL
BNC743195-100 1x 100 µL

MCM7 (Proliferation Marker) (rMCM7/1468), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human IL-5 Protein (His Tag)
PDMH100455-01 20 µg

Recombinant Human IL-5 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human IL-5 Protein (His Tag)
PDMH100455-02 100 µg

Recombinant Human IL-5 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human IL-5 Protein (His Tag)
PDMH100455-03 500 µg

Recombinant Human IL-5 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human IL-5 Protein (His Tag)
PDMH100455-04 1 mg

Recombinant Human IL-5 Protein (His Tag)

Sign In for Pricing
View Details
CD34 Mouse Monoclonal Antibody [Clone ID: ICO-115]
AM20322PU-S 100 µg

CD34 Mouse Monoclonal Antibody [Clone ID: ICO-115]

Sign In for Pricing
View Details