Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class alpha-18 (sra-18)

This Recombinant Serpentine receptor class alpha-18 (sra-18) spans the amino acid sequence from region 1-340.

Product Specifications

Product Name Alternative

Serpentine receptor class alpha-18, Protein sra-18

UniProt

O18689

Expression Region

1-340

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKTAEELDSRNCASESLTNALISITMKFNFIFIITVVLISYCFTWLAIQALWKHNIFSN STRLILIVCLLNSVVHQTTMLETRITQAYRSVVYDSEPCKLLFRSSDCVFELYLYYPTGY FSTYSVFSLTFDRLISHYKSRYYHMHQYFIATSLLVLQLLLTMFSFYIVFYGVSLAGYVP MCNFRPELTVYYGAINNVRTGVMVSCIIVTMFVYYVCVKSEKQIQKCSYSPGERYSAYEN VTTSQSICISIVLQFSCIMISSFGSNLLIHITSKTTVSEEVFYAIVSFLPGVTYANLCLP LVIYFKTKLTTRNRKNRIAVMTSMYGDAGEHIDRLKRSWE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p90 Autoantigen (KIAA1524) Mouse Monoclonal Antibody [Clone ID: OTI1C11]
CF808416 100 µg

p90 Autoantigen (KIAA1524) Mouse Monoclonal Antibody [Clone ID: OTI1C11]

Sign In for Pricing
View Details
Tdrd5 Mouse Gene Knockout Kit (CRISPR)
KN517377 1 Kit

Tdrd5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse VEGFR-2/KDR (Vascular Endothelial Growth Factor Receptor 2) ELISA Kit
E-EL-M0649-01 24 Tests

Mouse VEGFR-2/KDR (Vascular Endothelial Growth Factor Receptor 2) ELISA Kit

Sign In for Pricing
View Details
Mouse VEGFR-2/KDR (Vascular Endothelial Growth Factor Receptor 2) ELISA Kit
E-EL-M0649-02 48 Tests

Mouse VEGFR-2/KDR (Vascular Endothelial Growth Factor Receptor 2) ELISA Kit

Sign In for Pricing
View Details
Mouse VEGFR-2/KDR (Vascular Endothelial Growth Factor Receptor 2) ELISA Kit
E-EL-M0649-03 96 Tests

Mouse VEGFR-2/KDR (Vascular Endothelial Growth Factor Receptor 2) ELISA Kit

Sign In for Pricing
View Details
CF®660C F (ab') 2 fragment of Goat Anti-Mouse IgG (H+L), 2 mg/mL
#20918-250uL 1x 250 µL

CF®660C F (ab') 2 fragment of Goat Anti-Mouse IgG (H+L), 2 mg/mL

Sign In for Pricing
View Details