Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class alpha-23 (sra-23)

This Recombinant Serpentine receptor class alpha-23 (sra-23) spans the amino acid sequence from region 1-340.

Product Specifications

Product Name Alternative

Serpentine receptor class alpha-23, Protein sra-23

UniProt

O62367

Expression Region

1-340

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKTAEELLDSLKCASDGLASALTSVTLKFNCAFISTIVLISYCFSWLAIQALWNNNIFS NSTRLILIVCLLNSVVHQTTVMETRITQIYRSIVFASEPCEILFRSSECEIELYFYYLTN YFSTYSVFSLTFDRLISHYKSKYYHMHQYFIAISLLVLQFLLAILSFYIAYHGVPLAGYV PMCNYYPKMAVHHITINDVRTVVMVSCIIVTGFAYYLSVKSEKQIQKCSYSPGERYSAYE NVTTSQSVCILIVLQFSCTMISSFGVNLLLMMQEAVSEETFTKVGAFLPGVAYANLCLPL AIYFKTKLTIQNRKLRIAVMISMYGDVGEHIARLKKSWEY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGTR1A Antibody
OACD01517-1ML 1 mL

AGTR1A Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to LAMP1
MBS8596710-01 0.1 mL

Mouse Monoclonal Antibody to LAMP1

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to LAMP1
MBS8596710-02 0.1 mL (AF405L)

Mouse Monoclonal Antibody to LAMP1

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to LAMP1
MBS8596710-03 0.1 mL (AF405S)

Mouse Monoclonal Antibody to LAMP1

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to LAMP1
MBS8596710-04 0.1 mL (AF610)

Mouse Monoclonal Antibody to LAMP1

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to LAMP1
MBS8596710-05 0.1 mL (AF635)

Mouse Monoclonal Antibody to LAMP1

Sign In for Pricing
View Details