Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class alpha-23 (sra-23)

This Recombinant Serpentine receptor class alpha-23 (sra-23) spans the amino acid sequence from region 1-340.

Product Specifications

Product Name Alternative

Serpentine receptor class alpha-23, Protein sra-23

UniProt

O62367

Expression Region

1-340

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKTAEELLDSLKCASDGLASALTSVTLKFNCAFISTIVLISYCFSWLAIQALWNNNIFS NSTRLILIVCLLNSVVHQTTVMETRITQIYRSIVFASEPCEILFRSSECEIELYFYYLTN YFSTYSVFSLTFDRLISHYKSKYYHMHQYFIAISLLVLQFLLAILSFYIAYHGVPLAGYV PMCNYYPKMAVHHITINDVRTVVMVSCIIVTGFAYYLSVKSEKQIQKCSYSPGERYSAYE NVTTSQSVCILIVLQFSCTMISSFGVNLLLMMQEAVSEETFTKVGAFLPGVAYANLCLPL AIYFKTKLTIQNRKLRIAVMISMYGDVGEHIARLKKSWEY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CD28 Antibody [PerCP]
NB100-93558PCP 0.1 mL

Rabbit Polyclonal CD28 Antibody [PerCP]

Sign In for Pricing
View Details
Acid Phosphatase 1 (ACP1) Antibody
abx122382-01 100 µg

Acid Phosphatase 1 (ACP1) Antibody

Sign In for Pricing
View Details
Acid Phosphatase 1 (ACP1) Antibody
abx122382-02 1 mg

Acid Phosphatase 1 (ACP1) Antibody

Sign In for Pricing
View Details
ZNF687 sgRNA CRISPR Lentivector (Human) (Target 3)
K2725504 1.0 µg DNA

ZNF687 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Ammonium Sulfate
A8820 500 g

Ammonium Sulfate

Sign In for Pricing
View Details
2-Fluoro-3-formyl-6-methylbenzoic acid
PC1015253-01 250 mg

2-Fluoro-3-formyl-6-methylbenzoic acid

Sign In for Pricing
View Details