Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class alpha-23 (sra-23)

This Recombinant Serpentine receptor class alpha-23 (sra-23) spans the amino acid sequence from region 1-340.

Product Specifications

Product Name Alternative

Serpentine receptor class alpha-23, Protein sra-23

UniProt

O62367

Expression Region

1-340

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKTAEELLDSLKCASDGLASALTSVTLKFNCAFISTIVLISYCFSWLAIQALWNNNIFS NSTRLILIVCLLNSVVHQTTVMETRITQIYRSIVFASEPCEILFRSSECEIELYFYYLTN YFSTYSVFSLTFDRLISHYKSKYYHMHQYFIAISLLVLQFLLAILSFYIAYHGVPLAGYV PMCNYYPKMAVHHITINDVRTVVMVSCIIVTGFAYYLSVKSEKQIQKCSYSPGERYSAYE NVTTSQSVCILIVLQFSCTMISSFGVNLLLMMQEAVSEETFTKVGAFLPGVAYANLCLPL AIYFKTKLTIQNRKLRIAVMISMYGDVGEHIARLKKSWEY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Laminin beta 1 Rabbit mAb
orb1923375-01 20 ul

Laminin beta 1 Rabbit mAb

Sign In for Pricing
View Details
Laminin beta 1 Rabbit mAb
orb1923375-02 50 µL

Laminin beta 1 Rabbit mAb

Sign In for Pricing
View Details
Laminin beta 1 Rabbit mAb
orb1923375-03 100 µL

Laminin beta 1 Rabbit mAb

Sign In for Pricing
View Details
Histone H1 (H1) BioAssayTM ELISA Kit (Human)
517301 96 Tests

Histone H1 (H1) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Human IMPDH2 Pre-designed siRNA Set A
SI007650A 1 Each

Human IMPDH2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
1-Boc-4- (2-iodoethyl) piperidine
PDA15146-01 0.5 g

1-Boc-4- (2-iodoethyl) piperidine

Sign In for Pricing
View Details