Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Surface presentation of antigens protein spaS (spaS)

This Recombinant Surface presentation of antigens protein spaS (spaS) spans the amino acid sequence from region 1-342.

Product Specifications

Product Name Alternative

Surface presentation of antigens protein spaS, Spa40 protein

UniProt

P0A1M9

Expression Region

1-342

Origin

Shigella sonnei

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANKTEKPTPKKLKDAAKKGQSFKFKDLTTVVIILVGTFTIISFFSLSDVMLLYRYVIIN DFEINEGKYFFAVVIVFFKIIGFPLFFCVLSAVLPTLVQTKFVLATKAIKIDFSVLNPVK GLKKIFSIKTIKEFFKSILLLIILALTTYFFWINDRKIIFSQVFSSVDGLYLIWGRLFKD IILFFLAFSILVIILDFVIEFILYMKDMMMDKQEIKREYIEQEGHFETKSRRRELHIEIL SEQTKSDIRNSKLVVMNPTHIAIGIYFNPEIAPAPFISLIETNQCALAVRKYANEVGIPT VRDVKLARKLYKTHTKYSFVDFEHLDEVLRLIVWLEQVENTH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFPL3 Mouse Monoclonal Antibody [Clone 2A6]
E45M12646V-2 50 µL

RFPL3 Mouse Monoclonal Antibody [Clone 2A6]

Sign In for Pricing
View Details
CXCL2 Antibody
KC-46410-01 50 μL

CXCL2 Antibody

Sign In for Pricing
View Details
CXCL2 Antibody
KC-46410-02 100 µL

CXCL2 Antibody

Sign In for Pricing
View Details
CXCL2 Antibody
KC-46410-03 1 mL

CXCL2 Antibody

Sign In for Pricing
View Details
Optimedin Rabbit Polyclonal Antibody (FITC)
orb7862 100 µL

Optimedin Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Spectinamide 1599
orb1691576 25 mg

Spectinamide 1599

Sign In for Pricing
View Details