Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Aquaporin-7 (AQP7)

This Recombinant Macaca fascicularis Aquaporin-7 (AQP7) spans the amino acid sequence from region 1-342.

Product Specifications

Product Name Alternative

Aquaporin-7, AQP-7, Aquaglyceroporin-7

UniProt

Q4R691

Expression Region

1-342

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Kidney & Urological Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVQTSRHRRSTRGSKMVSWSVMAKIQEILQKKMVREFLAEFMSTYVMMVFGLGSVAHMVL NKKYGSYLGVNLGFGFGVTMGVHVAGHISGAHMNAAVTFANCALGRVPWRKFPVYVLGQF LGSFLAAATIYTLFYTAILHFSGGQLMVTGPVATAGIFATYLPDHMTLWRGFLNEAWLTG MLQLCLFAITDQENNAALPGTQALVIGILVVIIGVSLGMNTGYAINPSRDLPPRVFTFIA GWGKEVFSEGENWWWVPVVAPLLGACLGGIIYLVFIGSTTPREPLKLEDSVAYEDHGITV LPKMGSHEPTISPLTPVSVSPANRSSVRPAPPLHESMALGHF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL
BNC740270-100 1x 100 µL

Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF405S conjugate, 0.1mg/mL
BNC041073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL
BNC040679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF594 conjugate, 0.1mg/mL
BNC940345-100 1x 100 µL

CD4 (EDU-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL
BNC040276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), CF640R conjugate, 0.1mg/mL
BNC402984-500 1x 500 µL

Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details