Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Iron stress-induced chlorophyll-binding protein (isiA)

This Recombinant Synechococcus sp. Iron stress-induced chlorophyll-binding protein (isiA) spans the amino acid sequence from region 1-342.

Product Specifications

Product Name Alternative

Iron stress-induced chlorophyll-binding protein, CP43'

UniProt

P31157

Expression Region

1-342

Origin

Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (Agmenellum quadruplicatum)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQTYDNPDVKYEWWAGNARFADLSGQFIGAHVAHAALIVFWAGAFTLFEISYFDPTLPMG EQNLILLPHLATLGLGIEGNGAINTEPYFVIGAIHLISSAVLAAGGLFHVLRGPQDLKTA TGPARRFHFDWEDPKQLGLILGHHLLLLGLGAFLLVAKAMYFGGLYDTATQTVRLVTEPT LDPAVIYGYQTHFATVDNLEDIVGGHIYVGVLLVAGGIWHILVPPLQWAKKVLLFSGEAI LSYSLGAIALAGFVAAYFCAVNTTAYPVEFYGPVLDVKLSIVPYFADTIELPMNEHTSRA WLANAHFFFAFFFLQGHLWHALRAMGFDFRRVEKVLSDPLDA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD40 Mouse Monoclonal Antibody [Clone ID: OTI5C9]
CF807683 100 µg

CD40 Mouse Monoclonal Antibody [Clone ID: OTI5C9]

Sign In for Pricing
View Details
BCL2 Mouse Monoclonal Antibody [Clone ID: OTI1H1]
CF806624 100 µg

BCL2 Mouse Monoclonal Antibody [Clone ID: OTI1H1]

Sign In for Pricing
View Details
COMMD6 Antibody
KC-45470-01 50 μL

COMMD6 Antibody

Sign In for Pricing
View Details
COMMD6 Antibody
KC-45470-02 100 µL

COMMD6 Antibody

Sign In for Pricing
View Details
COMMD6 Antibody
KC-45470-03 1 mL

COMMD6 Antibody

Sign In for Pricing
View Details
MIR205HG Human Gene Knockout Kit (CRISPR)
KN415980 1 Kit

MIR205HG Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details