Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lipid phosphate phosphatase-related protein type 2 (Lppr2)

This Recombinant Mouse Lipid phosphate phosphatase-related protein type 2 (Lppr2) spans the amino acid sequence from region 1-343.

Product Specifications

Product Name Alternative

Lipid phosphate phosphatase-related protein type 2, EC= 3.1.3.4, Plasticity-related gene 4 protein, PRG-4

UniProt

Q8VCY8

Expression Region

1-343

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGGRPHLKRSFSIIPCFVFVESVLLGIVVLLAYRLEFTDTFPVHTQGFFCYDSAYAKPY PGPEAASRAPPALIYALVTAGPTLTILLGELARAFFPAPPSSSPVSGESTIVSGACCRFS PPLRRLVRFLGVYSFGLFTTTIFANAGQVVTGNPTPHFLSVCRPNYTALGCPPPSPDRPG PDRFVTDQSACAGSPSLVAAARRAFPCKDAALCAYAVTYTAMYVTLVFRVKGSRLVKPSL CLALLCPAFLVGVVRVAEYRNHWSDVLAGFLTGAAIATFLVTCVVHNFQSRPHSGRRLSP WEDLSQAPTMDSPLEKNPRPAGRIRHRHGSPHPSRRTVPAVAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MELK Antibody
8C11043-AAT 50 µg

MELK Antibody

Sign In for Pricing
View Details
Recombinant SP1 Monoclonal Antibody
AN301966L-01 50 µL

Recombinant SP1 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant SP1 Monoclonal Antibody
AN301966L-02 100 µL

Recombinant SP1 Monoclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS702822 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS806103 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Dioctadecyl 3,3’-Thiodipropionate
TRC-D481190-5G 5 g

Dioctadecyl 3,3’-Thiodipropionate

Sign In for Pricing
View Details