Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Probable polyprenol reductase 2 (At2g16530)

This Recombinant Arabidopsis thaliana Probable polyprenol reductase 2 (At2g16530) spans the amino acid sequence from region 1-343.

Product Specifications

Product Name Alternative

Probable polyprenol reductase 2, EC= 1.3.1.-

UniProt

Q9SI62

Expression Region

1-343

Origin

Arabidopsis thaliana (Mouse-ear cress)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVELEIVWLVRGAWITVWIVSILPLVIASIPTSKLNSFRELVLSFAGRGKILHPSSQKFT IPQKCFAHFYVIGVVWTTLLLAATWMYACKMAPLSSEEFQLSDIASRLAGGSDVFSVHKS NMTPVEHRFKVWRAVFLLLLMEIHVLRRLIESFYVFKYSPSARMHILGYFAGLFFYVTAP LSLCSNIAPEVAGFVGNQVAEFIANGKSHTSAPEFNLLSSISPLMKLGSLQWIGGAIFLW GWIHQRRCHAILGSLRENPSQAKEYIIPYGDWFGMVSSPHFLAEIVLYAGLLIASGGTDI TIWLLFGFVAANLTYAAGETHRWYLRKFENYPANRHAIFPYVY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD104 (UM-A9), CF647 conjugate, 0.1mg/mL
BNC470449-100 1x 100 µL

CD104 (UM-A9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF647 conjugate, 0.1mg/mL
BNC470029-500 1x 500 µL

Fibronectin (TV-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF740 conjugate, 0.1mg/mL
BNC740253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF594 conjugate, 0.1mg/mL
BNC940449-100 1x 100 µL

CD104 (UM-A9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL
BNC740050-500 1x 500 µL

IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2714), CF568 conjugate, 0.1mg/mL
BNC682714-500 1x 500 µL

Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2714), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details