Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2058 (AF_2058)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2058 (AF_2058) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_2058

UniProt

O28221

Expression Region

1-344

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPKKLVLVIDRDDDLGQKAGISSPVIGRDNIVSAAVRLGTADPEDSDVNAMFAAIKIYDE LKGRGEDVEVVVVCGDRSVGVVSDSKIAEQLDRVVLNLRPSSAIVVTDGSEDEFVLPIIS SRVKIDSVHRVVVRQSRTIESTYFLIRRMLNDPKIARITLAPLGMIFLVYSIFLVMQHPE WGLGGIIFFLGVYFMVKAYGWEQNIANLLETVRVSLVEGRLSFIFYVTSAILLIISIVNG FNAAVNIADAAQAISSFIFYSTWWFVLSGIFALLARAADAYAEKRRVSKYFTIIFLLIAF GLIVWASAAYVLNPEAPNALQNLAGAIVGAILIAAIGVFTLKRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD73 (NT5E) (NM_002526) Human Over-expression Lysate
LC419270 20 µg

CD73 (NT5E) (NM_002526) Human Over-expression Lysate

Sign In for Pricing
View Details
PE Armenian Hamster IgG Isotype Control[PIP]
E-AB-F09853D-01 25 µg

PE Armenian Hamster IgG Isotype Control[PIP]

Sign In for Pricing
View Details
PE Armenian Hamster IgG Isotype Control[PIP]
E-AB-F09853D-02 100 µg

PE Armenian Hamster IgG Isotype Control[PIP]

Sign In for Pricing
View Details
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/1878R), CF405S conjugate, 0.1mg/mL
BNC041878-100 1x 100 µL

Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/1878R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DR5 (TNFRSF10B) (NM_147187) Human Recombinant Protein
TP319808 20 µg

DR5 (TNFRSF10B) (NM_147187) Human Recombinant Protein

Sign In for Pricing
View Details
APC2 Rabbit Polyclonal Antibody
AP23515PU-N 50 µg

APC2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details