Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 236 (Tmem236)

This Recombinant Mouse Transmembrane protein 236 (Tmem236) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Transmembrane protein 236

UniProt

A2ARJ3

Expression Region

1-344

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASGKIIKLVVFELLEFAAFSIPTLVIMEQFATANQRTKSERTHYWLIVSCSIAYVAVVS LLIWVPVKVVLYKKRHLYKKIIGWRPVLVMCVVLTTLPSFSFSIAVTEVQKNINGSANSL PESLPDLPVSLVLLSLIVVDIIEKLRQYPLRGSQKGYEDNDICITSLQQIKTVTEQVVQS DGNPASAQAAKPTAMSQPRNHVAVLAGPLEPSFQSRILRTMSQRDVRAELFLRSFLMWAD TVEMLRVAGHQAVYKSAWLYPVYIFSFISLLRMVFTPKNPLLNSLGILMQDLPFVFLRLS LILALGTITPVLGLCKNVLVTISYIYFNYVTKLRPFSAFETSPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-U1A/SNRPA (Rabbit, Polyclonal)
A122802 100 µL

Anti-U1A/SNRPA (Rabbit, Polyclonal)

Sign In for Pricing
View Details
CRH Polyclonal Antibody
E-AB-65809-01 60 µL

CRH Polyclonal Antibody

Sign In for Pricing
View Details
CRH Polyclonal Antibody
E-AB-65809-02 120 µL

CRH Polyclonal Antibody

Sign In for Pricing
View Details
CRH Polyclonal Antibody
E-AB-65809-03 200 µL

CRH Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Bombyx mori Fibroin heavy chain (FIBH), partial
MBS1158639-01 0.02 mg (E-Coli)

Recombinant Bombyx mori Fibroin heavy chain (FIBH), partial

Sign In for Pricing
View Details
Recombinant Bombyx mori Fibroin heavy chain (FIBH), partial
MBS1158639-02 0.1 mg (E-Coli)

Recombinant Bombyx mori Fibroin heavy chain (FIBH), partial

Sign In for Pricing
View Details