Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Iron stress-induced chlorophyll-binding protein (isiA)

This Recombinant Iron stress-induced chlorophyll-binding protein (isiA) spans the amino acid sequence from region 1-345.

Product Specifications

Product Name Alternative

Iron stress-induced chlorophyll-binding protein, CP43'

UniProt

Q9F488

Expression Region

1-345

Origin

Fischerella muscicola

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQTYDNPKVKYDWWAGNARFANLSGLFIGAHVAQAALTTLWAGAFTWFELSRYQSGVPMG EQGLILLPHLATLGFGVGAGGQIVDTYPYFVIGALHIISSAVLGAGALLHTFKGPENLKD ATGPAREFHFEWDDANKLGLILGHHLLFLGAGALLLVAKAMFWGGLYDTTIHDVRVVTEP TLNPFIIFGYQTHFASVDNLEDVVGGHIYVGLLLIFGGVWHILVKPLAWAKKLLIFSGEA ILSYSLGGIALAGFVAAYFCAVNTLAYPVEFYGPPLEVKFWYLRPYFADTIQLPYGNYTS RAWLANTHFFLAFFFLQGHLWHALRAIGFDFKRVEKALSAVETSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster Melatonin Receptor 1B Antibody ELISA kit
GTR10407914 96 Well

Hamster Melatonin Receptor 1B Antibody ELISA kit

Sign In for Pricing
View Details
Wdr95 (NM_029440) Mouse Untagged Clone
MC220048 10 µg

Wdr95 (NM_029440) Mouse Untagged Clone

Sign In for Pricing
View Details
PCSK7 Antibody, Biotin conjugated
CSB-PA017646LD01HU-01 50 µg

PCSK7 Antibody, Biotin conjugated

Sign In for Pricing
View Details
PCSK7 Antibody, Biotin conjugated
CSB-PA017646LD01HU-02 100 µg

PCSK7 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Prl8a9 ORF Vector (Rat) (pORF)
ORF074063 1.0 µg DNA

Prl8a9 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Xrcc1 ORF Vector (Rat) (pORF)
ORF079220 1.0 µg DNA

Xrcc1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details