Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Iron stress-induced chlorophyll-binding protein (isiA)

This Recombinant Iron stress-induced chlorophyll-binding protein (isiA) spans the amino acid sequence from region 1-345.

Product Specifications

Product Name Alternative

Iron stress-induced chlorophyll-binding protein, CP43'

UniProt

Q9F488

Expression Region

1-345

Origin

Fischerella muscicola

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQTYDNPKVKYDWWAGNARFANLSGLFIGAHVAQAALTTLWAGAFTWFELSRYQSGVPMG EQGLILLPHLATLGFGVGAGGQIVDTYPYFVIGALHIISSAVLGAGALLHTFKGPENLKD ATGPAREFHFEWDDANKLGLILGHHLLFLGAGALLLVAKAMFWGGLYDTTIHDVRVVTEP TLNPFIIFGYQTHFASVDNLEDVVGGHIYVGLLLIFGGVWHILVKPLAWAKKLLIFSGEA ILSYSLGGIALAGFVAAYFCAVNTLAYPVEFYGPPLEVKFWYLRPYFADTIQLPYGNYTS RAWLANTHFFLAFFFLQGHLWHALRAIGFDFKRVEKALSAVETSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Scgb1b30 (NM_001100859) Rat Tagged ORF Clone Lentiviral Particle
RR206723L3V 200 µL

Scgb1b30 (NM_001100859) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CD47 (Antigenic Surface Determinant Protein OA3, IAP, Integrin Associated Protein, Integrin Associated Signal Transducer, MER6, OA3, Protein MER6, Rh Related Antigen) (APC)
MBS6122784-01 0.1 mL

CD47 (Antigenic Surface Determinant Protein OA3, IAP, Integrin Associated Protein, Integrin Associated Signal Transducer, MER6, OA3, Protein MER6, Rh Related Antigen) (APC)

Sign In for Pricing
View Details
CD47 (Antigenic Surface Determinant Protein OA3, IAP, Integrin Associated Protein, Integrin Associated Signal Transducer, MER6, OA3, Protein MER6, Rh Related Antigen) (APC)
MBS6122784-02 5x 0.1 mL

CD47 (Antigenic Surface Determinant Protein OA3, IAP, Integrin Associated Protein, Integrin Associated Signal Transducer, MER6, OA3, Protein MER6, Rh Related Antigen) (APC)

Sign In for Pricing
View Details
Goat anti-Il12b / Il12p40 (mouse) Antibody
orb19735 100 µg

Goat anti-Il12b / Il12p40 (mouse) Antibody

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Superoxide Dismutase 1 (SOD1)
MBS2145354-01 0.1 mL

Cy3-Linked Monoclonal Antibody to Superoxide Dismutase 1 (SOD1)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Superoxide Dismutase 1 (SOD1)
MBS2145354-02 0.2 mL

Cy3-Linked Monoclonal Antibody to Superoxide Dismutase 1 (SOD1)

Sign In for Pricing
View Details