Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acidianus bottle-shaped virus Putative transmembrane protein ORF346 (ORF346)

This Recombinant Acidianus bottle-shaped virus Putative transmembrane protein ORF346 (ORF346) spans the amino acid sequence from region 1-346.

Product Specifications

Product Name Alternative

Putative transmembrane protein ORF346

UniProt

A4ZUD1

Expression Region

1-346

Origin

Acidianus bottle-shaped virus (isolate Italy/Pozzuoli) (ABV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSCVSQSAGSLPPLCQWSGLEPICKIPPSQQFQQIHCPLITKHRSSKLCDLLPPGVTDSI YDFLANLPIILLFVASVPARFIYCIVYNFLLNFDQFILGIEYSIINPILDFFTAPLVYLA VGLTDGENNSAFSPPYLIGVLTDACLPGIVSGIYQAIGDIFYTIGYGIGFILGLFIDLYD IILYSICTLVTFGLTFGLCLSYDIVGIFKGAGGLKFTIYPFSFLAGLLQNYINCGCVLGS YPTAYIILCLNFGGSCPSCCPCGVGFTPPACPAIPNGTPPSPVNLSVTGQGCVSEYPHSE NGSGGSGGSGSGSGSGGSGSGGNSGSGGSGSGSSGSGGNSGSGNNG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL
BNC940460-500 1x 500 µL

CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL
BNC040040-500 1x 500 µL

CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL
BNC942216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL
BNC680304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL