Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorophyll a/b light-harvesting protein pcbB (pcbB)

This Recombinant Chlorophyll a/b light-harvesting protein pcbB (pcbB) spans the amino acid sequence from region 1-347.

Product Specifications

Product Name Alternative

Chlorophyll a/b light-harvesting protein pcbB

UniProt

P95504

Expression Region

1-347

Origin

Prochlorothrix hollandica

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQTYGSRNVDYGWWAGNSRFADRTGLWLAAHVAQASFIVLWAGAITLFEVARYTPSIPMG EQGLILIPHLAALGIGVGAGGVVVNTFPYTAIGAVHLISSFVFAFGAIFHVRFGPESIGE GSDSKFAFSWDDPKQLGLILGHHLLLLGLGAIFFVGWIRFHGVYDSTIGDVRIVSNPGAT ILSVIFEYGWFTPEHNPFFVNNLEDLASGHAFIGVVLLSGGVWHITQEPFAWAQRLLASL FSAEGLLSSALAGLSMLGFAAAYFSAVNTLAYPIEFFGPPLELQFNIMPYFVDSVDLPAG VYSARAWLCNVHFYLAFFVLQGHLWHAIRAIGFDFKKVSNAFATLSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SATB2 Recombinant Rabbit mAb
BS47695-01 50 µL

SATB2 Recombinant Rabbit mAb

Sign In for Pricing
View Details
SATB2 Recombinant Rabbit mAb
BS47695-02 100 µL

SATB2 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Mouse Monoclonal Cathepsin Z Antibody (05) [Allophycocyanin]
NBP3-26880APC 0.1 mL

Mouse Monoclonal Cathepsin Z Antibody (05) [Allophycocyanin]

Sign In for Pricing
View Details
Bax Recombinant Rabbit mAb, BF350 conjugated
orb1574258 100 µL

Bax Recombinant Rabbit mAb, BF350 conjugated

Sign In for Pricing
View Details
KIRREL2 Protein Vector (Mouse) (pPM-C-HA)
PV194412 500 ng

KIRREL2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
TRIM27 Rabbit Polyclonal Antibody
TA382815 100 µL

TRIM27 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details