Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorophyll a/b light-harvesting protein pcbB (pcbB)

This Recombinant Chlorophyll a/b light-harvesting protein pcbB (pcbB) spans the amino acid sequence from region 1-347.

Product Specifications

Product Name Alternative

Chlorophyll a/b light-harvesting protein pcbB

UniProt

P95504

Expression Region

1-347

Origin

Prochlorothrix hollandica

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQTYGSRNVDYGWWAGNSRFADRTGLWLAAHVAQASFIVLWAGAITLFEVARYTPSIPMG EQGLILIPHLAALGIGVGAGGVVVNTFPYTAIGAVHLISSFVFAFGAIFHVRFGPESIGE GSDSKFAFSWDDPKQLGLILGHHLLLLGLGAIFFVGWIRFHGVYDSTIGDVRIVSNPGAT ILSVIFEYGWFTPEHNPFFVNNLEDLASGHAFIGVVLLSGGVWHITQEPFAWAQRLLASL FSAEGLLSSALAGLSMLGFAAAYFSAVNTLAYPIEFFGPPLELQFNIMPYFVDSVDLPAG VYSARAWLCNVHFYLAFFVLQGHLWHAIRAIGFDFKKVSNAFATLSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse DPEP1 Protein, His (Fc)-Avi-tagged
DPEP1-2495M 50 µg

Recombinant Mouse DPEP1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
SLC1A2 Blocking Peptide
33R-7118 100 ug

SLC1A2 Blocking Peptide

Sign In for Pricing
View Details
CD38 Polyclonal Antibody, PerCP Conjugated
bs-0979R-PerCP-TR 20 µL

CD38 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Ino80 3'UTR Luciferase Stable Cell Line
TU110127 1.0 mL

Ino80 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
SRP19 (NM_003135) Human Tagged ORF Clone
RG203129 10 µg

SRP19 (NM_003135) Human Tagged ORF Clone

Sign In for Pricing
View Details
FAM58A (CCNQ) (NM_001130997) Human Tagged ORF Clone Lentiviral Particle
RC225281L3V 200 µL

FAM58A (CCNQ) (NM_001130997) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details