Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorophyll a/b light-harvesting protein pcbB (pcbB)

This Recombinant Chlorophyll a/b light-harvesting protein pcbB (pcbB) spans the amino acid sequence from region 1-347.

Product Specifications

Product Name Alternative

Chlorophyll a/b light-harvesting protein pcbB

UniProt

P95504

Expression Region

1-347

Origin

Prochlorothrix hollandica

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQTYGSRNVDYGWWAGNSRFADRTGLWLAAHVAQASFIVLWAGAITLFEVARYTPSIPMG EQGLILIPHLAALGIGVGAGGVVVNTFPYTAIGAVHLISSFVFAFGAIFHVRFGPESIGE GSDSKFAFSWDDPKQLGLILGHHLLLLGLGAIFFVGWIRFHGVYDSTIGDVRIVSNPGAT ILSVIFEYGWFTPEHNPFFVNNLEDLASGHAFIGVVLLSGGVWHITQEPFAWAQRLLASL FSAEGLLSSALAGLSMLGFAAAYFSAVNTLAYPIEFFGPPLELQFNIMPYFVDSVDLPAG VYSARAWLCNVHFYLAFFVLQGHLWHAIRAIGFDFKKVSNAFATLSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rad51B (1H3/13) Alexa Fluor® 488
sc-53430 AF488 200 µg/mL

Rad51B (1H3/13) Alexa Fluor® 488

Sign In for Pricing
View Details
ZNF18 Antibody
MBS8587271-01 0.1 mg

ZNF18 Antibody

Sign In for Pricing
View Details
ZNF18 Antibody
MBS8587271-02 0.1 mL (AF405L)

ZNF18 Antibody

Sign In for Pricing
View Details
ZNF18 Antibody
MBS8587271-03 0.1 mL (AF405S)

ZNF18 Antibody

Sign In for Pricing
View Details
ZNF18 Antibody
MBS8587271-04 0.1 mL (AF610)

ZNF18 Antibody

Sign In for Pricing
View Details
ZNF18 Antibody
MBS8587271-05 0.1 mL (AF635)

ZNF18 Antibody

Sign In for Pricing
View Details