Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class alpha-29 (sra-29)

This Recombinant Serpentine receptor class alpha-29 (sra-29) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Serpentine receptor class alpha-29, Protein sra-29

UniProt

Q19552

Expression Region

1-348

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNPACASEDVKNALTSPIMMLSHGFILMIIVVSFITTALAVQTLWYKNVFPFCTKNL LLSAIVNGIFHQSTVAEIRLKTVYHLIRYSNAPCSILFQSSDCFYDNFLYYQTALFSSFY CVSLFLDRLFSLNPRSFYNSHQTLGFIVFLILQIICPIAIQFWTFHDSDYTSYVPMCNYP PASSVSGTKFYFINDSRIIIMGTIFMCSLFLYIHNKSREKRMIFNVYNTDSRYKSYENFL ATRAVCIIIFSQITCLGITSFVPSIFNQFRQSISPDWFHLILAFMAGATYSNFFLPLIVI YETQLIIAHRHKLIKKLKSQKEEFSDHFASLDFVWEREANKKKTQLVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Isotype Control, Mouse IgG1 Kappa (IGG1/1331), CF405L conjugate, 0.1mg/mL
BNC061331-250 1x 250 µL

Isotype Control, Mouse IgG1 Kappa (IGG1/1331), CF405L conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Shugoshin (SGO1) (NM_001012411) Human Recombinant Protein
TP313965 20 µg

Shugoshin (SGO1) (NM_001012411) Human Recombinant Protein

Sign In for Pricing
View Details
CD68 Polyclonal Antibody
E-AB-64533-01 60 µL

CD68 Polyclonal Antibody

Sign In for Pricing
View Details
CD68 Polyclonal Antibody
E-AB-64533-02 120 µL

CD68 Polyclonal Antibody

Sign In for Pricing
View Details
CD68 Polyclonal Antibody
E-AB-64533-03 200 µL

CD68 Polyclonal Antibody

Sign In for Pricing
View Details
Biotin Conjugated Rabbit Polyclonal Antibody to Feline IgG
BA-2356-2 2 mL

Biotin Conjugated Rabbit Polyclonal Antibody to Feline IgG

Sign In for Pricing
View Details