Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class alpha-29 (sra-29)

This Recombinant Serpentine receptor class alpha-29 (sra-29) spans the amino acid sequence from region 1-348.

Product Specifications

Product Name Alternative

Serpentine receptor class alpha-29, Protein sra-29

UniProt

Q19552

Expression Region

1-348

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNPACASEDVKNALTSPIMMLSHGFILMIIVVSFITTALAVQTLWYKNVFPFCTKNL LLSAIVNGIFHQSTVAEIRLKTVYHLIRYSNAPCSILFQSSDCFYDNFLYYQTALFSSFY CVSLFLDRLFSLNPRSFYNSHQTLGFIVFLILQIICPIAIQFWTFHDSDYTSYVPMCNYP PASSVSGTKFYFINDSRIIIMGTIFMCSLFLYIHNKSREKRMIFNVYNTDSRYKSYENFL ATRAVCIIIFSQITCLGITSFVPSIFNQFRQSISPDWFHLILAFMAGATYSNFFLPLIVI YETQLIIAHRHKLIKKLKSQKEEFSDHFASLDFVWEREANKKKTQLVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurokinin 3 Receptor NK3 (TACR3) Rabbit Polyclonal Antibody
TA372269 100 µL

Neurokinin 3 Receptor NK3 (TACR3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human Cystatin 7/CST7 Protein
PKSH031811 20 µg

Recombinant Human Cystatin 7/CST7 Protein

Sign In for Pricing
View Details
Hexanedioic-d8 Acid Dihydrazide
TRC-A291596-10MG 10 mg

Hexanedioic-d8 Acid Dihydrazide

Sign In for Pricing
View Details
CD44v6 (Marker of Tumor Metastasis) (CD44V6/2496), CF647 conjugate, 0.1mg/mL
BNC472496-500 1x 500 µL

CD44v6 (Marker of Tumor Metastasis) (CD44V6/2496), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Occludin (OCLN) (Tight Junctions Marker) (OCLN/2183), 0.2mg/mL
BNUB2183-100 1x 100 µL

Occludin (OCLN) (Tight Junctions Marker) (OCLN/2183), 0.2mg/mL

Sign In for Pricing
View Details
Human C14ORF21 (NOP9) activation kit by CRISPRa
GA116024 1 Kit

Human C14ORF21 (NOP9) activation kit by CRISPRa

Sign In for Pricing
View Details