Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbA (pcbA)

This Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbA (pcbA) spans the amino acid sequence from region 1-349.

Product Specifications

Product Name Alternative

Divinyl chlorophyll a/b light-harvesting protein pcbA

UniProt

Q46LS0

Expression Region

1-349

Origin

Prochlorococcus marinus (strain NATL2A)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQTYGNSAVTYGWWAGNSGVTNRSGKFIAAHAAHTGLIAFWAGAFTLFELARFDPSVPMG HQPLIALPHLATLGIGFDETGTFVGGSAVVAVAVCHLVGSMAYGAGGLMHSLLFSSDMQE SSVPQARKFKLEWDNPDNQTFILGHHLIFFGVACIWFVEWARIHGVYDPSIGAIRQVEYD LNLSHIWDHQFDFLTIDSLEDVMGGHAFLAFLEITGGAFHIATKQVGEYTKFKGAGLLSA EAILSWSLAGIGWMAVVAAFWSATNTTVYPVEWFGEPLALKFGISPYWVDTVDLGSAHTS RAWLANVHYYFGFFFIQGHLWHALRAMGFDFKRVTSALSNLDTASVSLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYK (NM_001135052) Human Tagged ORF Clone
RG226020 10 µg

SYK (NM_001135052) Human Tagged ORF Clone

Sign In for Pricing
View Details
L-Alanine Benzyl Ester Hydrochloride
MBS6065869-01 5 g

L-Alanine Benzyl Ester Hydrochloride

Sign In for Pricing
View Details
L-Alanine Benzyl Ester Hydrochloride
MBS6065869-02 25 g

L-Alanine Benzyl Ester Hydrochloride

Sign In for Pricing
View Details
L-Alanine Benzyl Ester Hydrochloride
MBS6065869-03 50 g

L-Alanine Benzyl Ester Hydrochloride

Sign In for Pricing
View Details
L-Alanine Benzyl Ester Hydrochloride
MBS6065869-04 5x 50 g

L-Alanine Benzyl Ester Hydrochloride

Sign In for Pricing
View Details
Punt Rabbit Polyclonal Antibody (BF680)
orb2467745 100 µL

Punt Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details