Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbA (pcbA)

This Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbA (pcbA) spans the amino acid sequence from region 1-349.

Product Specifications

Product Name Alternative

Divinyl chlorophyll a/b light-harvesting protein pcbA

UniProt

Q46LS0

Expression Region

1-349

Origin

Prochlorococcus marinus (strain NATL2A)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQTYGNSAVTYGWWAGNSGVTNRSGKFIAAHAAHTGLIAFWAGAFTLFELARFDPSVPMG HQPLIALPHLATLGIGFDETGTFVGGSAVVAVAVCHLVGSMAYGAGGLMHSLLFSSDMQE SSVPQARKFKLEWDNPDNQTFILGHHLIFFGVACIWFVEWARIHGVYDPSIGAIRQVEYD LNLSHIWDHQFDFLTIDSLEDVMGGHAFLAFLEITGGAFHIATKQVGEYTKFKGAGLLSA EAILSWSLAGIGWMAVVAAFWSATNTTVYPVEWFGEPLALKFGISPYWVDTVDLGSAHTS RAWLANVHYYFGFFFIQGHLWHALRAMGFDFKRVTSALSNLDTASVSLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLYAT Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV687356 1.0 µg DNA

GLYAT Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
RNA binding motif Protein 17
332928 100 µL

RNA binding motif Protein 17

Sign In for Pricing
View Details
Mouse Eya2 qPCR Primer Pair
QM12914S 200 Tests

Mouse Eya2 qPCR Primer Pair

Sign In for Pricing
View Details
GAB1 Rabbit Monoclonal Antibody
orb547926 100 µL

GAB1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
P-cadherin Rabbit Polyclonal Antibody (PE)
orb499089 100 µL

P-cadherin Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Rabbit Polyclonal WDR64 Antibody [Biotin]
NBP2-98172B 0.1 mL

Rabbit Polyclonal WDR64 Antibody [Biotin]

Sign In for Pricing
View Details