Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorophyll a/b light-harvesting protein pcbA (pcbA)

This Recombinant Chlorophyll a/b light-harvesting protein pcbA (pcbA) spans the amino acid sequence from region 2-350.

Product Specifications

Product Name Alternative

Chlorophyll a/b light-harvesting protein pcbA

UniProt

P95503

Expression Region

2-350

Origin

Prochlorothrix hollandica

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ATTATPEYGWWAGNSRFALQSGKWLSAHIAQYALITFWAGGITLFELARYNPDVSMGEQG LILIPHLATLGWGIGSGGQVVDTYPYFVIGVIHLVASAVFGAGALYHALKGPEDLSQSDF EFAKNFHFEWDDAAKLGNILGHHLLTLGYAALLFVIWLRFHGVYDSTIGEVRVVTNPGAT ILSVLFEYGWFTPDHNPYFVNNLEDLASGHAYIAVVLLAGGFWHINQAPFPWAQRLLASL FSPEGLLSASLAGLSMAGFAAAYFSAVNTLAYPVEFFGPPLELKFSVAPYFVDTIDLPNG AHTARAWLCNVHFFLAFFVLQGHLWHALRALGFDFKRIPQALGSLSGEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bcdin3d Mouse Gene Knockout Kit (CRISPR)
KN502088 1 Kit

Bcdin3d Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZNF2 Human qPCR Primer Pair (NM_021088)
HP226552 200 Reactions

ZNF2 Human qPCR Primer Pair (NM_021088)

Sign In for Pricing
View Details
RAD54B Rabbit Polyclonal Antibody
TA380674 100 µL

RAD54B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse CHL-1 Protein (Fc Tag)
PKSM040333 50 µg

Recombinant Mouse CHL-1 Protein (Fc Tag)

Sign In for Pricing
View Details
Palmitic Acid-d4
TRC-P144502-5MG 5 mg

Palmitic Acid-d4

Sign In for Pricing
View Details
REPS2 (NM_001080975) Human Recombinant Protein
TP317830 20 µg

REPS2 (NM_001080975) Human Recombinant Protein

Sign In for Pricing
View Details