Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorophyll a/b light-harvesting protein pcb (pcb)

This Recombinant Chlorophyll a/b light-harvesting protein pcb (pcb) spans the amino acid sequence from region 1-350.

Product Specifications

Product Name Alternative

Chlorophyll a/b light-harvesting protein pcb

UniProt

Q6Q972

Expression Region

1-350

Origin

Prochloron didemni

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGMQTYGNPDVEYGWWAGNSRLAGFSGKWLAAHVAQAALIVFWAGAICLFEVARYTADVP LGEQNLILIPHMASLGLGIGEGGQIVDTFPYFAVGVVHLVSSAVIGAGGLYHSLRGPAIL KEGPARAPKFDFDWGDGKRLGFILGHHLILLGLGALFLVLWAVFFGIYDPVIGEVRTVTS PTLNPFTIFGYQTHFVETNTLEDLIGGHVYVAIIEISGGLWHIFCPPFKWAQRLIIYSGE GLLAYALGGLAIMGFTAAVYCAFNTLAYPVEFYGPPLDFRFSFAPYFIDTADLPSGQYTA RAWLCNVHFFLAFFVLQGHLWHALRTLGFDFKRIPAALGSLSEDVVDAKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rad9, phosphorylated (Tyr28) (RAD9A, Cell Cycle Checkpoint Control Protein RAD9A, hRAD9, DNA Repair Exonuclease Rad9 Homolog A) (Biotin) discontinued
R0444-67K-Biotin 200 µL

Rad9, phosphorylated (Tyr28) (RAD9A, Cell Cycle Checkpoint Control Protein RAD9A, hRAD9, DNA Repair Exonuclease Rad9 Homolog A) (Biotin) discontinued

Sign In for Pricing
View Details
Recombinant Argyrosomus regius Osteocalcin (bglap)
MBS1286735-01 0.02 mg (E-Coli)

Recombinant Argyrosomus regius Osteocalcin (bglap)

Sign In for Pricing
View Details
Recombinant Argyrosomus regius Osteocalcin (bglap)
MBS1286735-02 0.1 mg (E-Coli)

Recombinant Argyrosomus regius Osteocalcin (bglap)

Sign In for Pricing
View Details
Recombinant Argyrosomus regius Osteocalcin (bglap)
MBS1286735-03 0.02 mg (Yeast)

Recombinant Argyrosomus regius Osteocalcin (bglap)

Sign In for Pricing
View Details
Recombinant Argyrosomus regius Osteocalcin (bglap)
MBS1286735-04 0.1 mg (Yeast)

Recombinant Argyrosomus regius Osteocalcin (bglap)

Sign In for Pricing
View Details
Recombinant Argyrosomus regius Osteocalcin (bglap)
MBS1286735-05 0.02 mg (Baculovirus)

Recombinant Argyrosomus regius Osteocalcin (bglap)

Sign In for Pricing
View Details