Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbB (pcbB)

This Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbB (pcbB) spans the amino acid sequence from region 1-350.

Product Specifications

Product Name Alternative

Divinyl chlorophyll a/b light-harvesting protein pcbB

UniProt

Q7V6U4

Expression Region

1-350

Origin

Prochlorococcus marinus (strain MIT 9313)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQTYGNPNPTYGWWAGNAGTTNRSGKFLAAHIAHTGLMAFWAGSFTLFELSRYDPSVPMG HQPLVALPHLATLGIGVGDGGVITDTYPIVVTAVLHLVLSMVYAAGGLMHSLLFNGDIGE MGVKWARKFDFKWDDPDKLTFILGHHLFLLGLGNVQFVEWAKYYGLYDNAEGVVRTVVPN LNIGMVWNAQFNFLAINSLEDVMGGHAFLALFMMSGGLWHIVTKQAGEYTTFKGKGILSA EAQLSWALAGVGWMALVAAFWCASNTTIYPDTFFGEVLDLKFSISPYWVDTANLPEGTYT SRAWLTNIHYYLGFFYIQGHLWHALRALGFDFKRVSNAIGNADSATITLN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dengue virus 3 prM protein IgG Antibody ELISA Kit, Human
VACY-1022-CY123 1 Kit

Dengue virus 3 prM protein IgG Antibody ELISA Kit, Human

Sign In for Pricing
View Details
Mouse Conserved oligomeric Golgi complex subunit 8 (COG8) ELISA Kit
MBS7230222-01 48 Well

Mouse Conserved oligomeric Golgi complex subunit 8 (COG8) ELISA Kit

Sign In for Pricing
View Details
Mouse Conserved oligomeric Golgi complex subunit 8 (COG8) ELISA Kit
MBS7230222-02 96 Well

Mouse Conserved oligomeric Golgi complex subunit 8 (COG8) ELISA Kit

Sign In for Pricing
View Details
Mouse Conserved oligomeric Golgi complex subunit 8 (COG8) ELISA Kit
MBS7230222-03 5x 96 Well

Mouse Conserved oligomeric Golgi complex subunit 8 (COG8) ELISA Kit

Sign In for Pricing
View Details
Mouse Conserved oligomeric Golgi complex subunit 8 (COG8) ELISA Kit
MBS7230222-04 10x 96 Well

Mouse Conserved oligomeric Golgi complex subunit 8 (COG8) ELISA Kit

Sign In for Pricing
View Details
Anti-BCR Antibody
CPA4350-01 30 µL

Anti-BCR Antibody

Sign In for Pricing
View Details