Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ceramide synthase 1 (CERS1)

This Recombinant Human Ceramide synthase 1 (CERS1) spans the amino acid sequence from region 1-350.

Product Specifications

Product Name Alternative

Ceramide synthase 1, CerS1, LAG1 longevity assurance homolog 1, Longevity assurance gene 1 protein homolog 1, Protein UOG-1

UniProt

P27544

Expression Region

1-350

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAAGPAAGPTGPEPMPSYAQLVQRGWGSALAAARGCTDCGWGLARRGLAEHAHLAPPEL LLLALGALGWTALRSAATARLFRPLAKRCCLQPRDAAKMPESAWKFLFYLGSWSYSAYLL FGTDYPFFHDPPSVFYDWTPGMAVPRDIAAAYLLQGSFYGHSIYATLYMDTWRKDSVVML LHHVVTLILIVSSYAFRYHNVGILVLFLHDISDVQLEFTKLNIYFKSRGGSYHRLHALAA DLGCLSFGFSWFWFRLYWFPLKVLYATSHCSLRTVPDIPFYFFFNALLLLLTLMNLYWFL YIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pour Point Tester BPTL-221
BPTL-221 1 Unit

Pour Point Tester BPTL-221

Sign In for Pricing
View Details
Human TEX51 activation kit by CRISPRa
GA119514 1 Kit

Human TEX51 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant GSTO1 Antibody
RN-061-01 50 μL

Recombinant GSTO1 Antibody

Sign In for Pricing
View Details
Recombinant GSTO1 Antibody
RN-061-02 100 µL

Recombinant GSTO1 Antibody

Sign In for Pricing
View Details
Recombinant GSTO1 Antibody
RN-061-03 1 mL

Recombinant GSTO1 Antibody

Sign In for Pricing
View Details
TentaGel® XV HMPA
XV18130.015.1G 1 g

TentaGel® XV HMPA

Sign In for Pricing
View Details