Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ceramide synthase 1 (CERS1)

This Recombinant Human Ceramide synthase 1 (CERS1) spans the amino acid sequence from region 1-350.

Product Specifications

Product Name Alternative

Ceramide synthase 1, CerS1, LAG1 longevity assurance homolog 1, Longevity assurance gene 1 protein homolog 1, Protein UOG-1

UniProt

P27544

Expression Region

1-350

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAAGPAAGPTGPEPMPSYAQLVQRGWGSALAAARGCTDCGWGLARRGLAEHAHLAPPEL LLLALGALGWTALRSAATARLFRPLAKRCCLQPRDAAKMPESAWKFLFYLGSWSYSAYLL FGTDYPFFHDPPSVFYDWTPGMAVPRDIAAAYLLQGSFYGHSIYATLYMDTWRKDSVVML LHHVVTLILIVSSYAFRYHNVGILVLFLHDISDVQLEFTKLNIYFKSRGGSYHRLHALAA DLGCLSFGFSWFWFRLYWFPLKVLYATSHCSLRTVPDIPFYFFFNALLLLLTLMNLYWFL YIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P21WAF1 (Tumor Suppressor Protein) (CIP1/2489R), Biotin conjugate, 0.1mg/mL
BNCB2489-500 1x 500 µL

P21WAF1 (Tumor Suppressor Protein) (CIP1/2489R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Alpk1 Mouse Gene Knockout Kit (CRISPR)
KN501164 1 Kit

Alpk1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human TAOK3 activation kit by CRISPRa
GA109757 1 Kit

Human TAOK3 activation kit by CRISPRa

Sign In for Pricing
View Details
LRRTM2 (NM_015564) Human Recombinant Protein
TP720484XL 1 mg

LRRTM2 (NM_015564) Human Recombinant Protein

Sign In for Pricing
View Details
PHKG2 (N-term) Rabbit Polyclonal Antibody
AP13916PU-N 400 µL

PHKG2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lewis a/b Rabbit Monoclonal Antibody [Clone ID: HEA164]
TA386331 200 µg

Lewis a/b Rabbit Monoclonal Antibody [Clone ID: HEA164]

Sign In for Pricing
View Details