Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ceramide synthase 1 (CERS1)

This Recombinant Human Ceramide synthase 1 (CERS1) spans the amino acid sequence from region 1-350.

Product Specifications

Product Name Alternative

Ceramide synthase 1, CerS1, LAG1 longevity assurance homolog 1, Longevity assurance gene 1 protein homolog 1, Protein UOG-1

UniProt

P27544

Expression Region

1-350

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAAGPAAGPTGPEPMPSYAQLVQRGWGSALAAARGCTDCGWGLARRGLAEHAHLAPPEL LLLALGALGWTALRSAATARLFRPLAKRCCLQPRDAAKMPESAWKFLFYLGSWSYSAYLL FGTDYPFFHDPPSVFYDWTPGMAVPRDIAAAYLLQGSFYGHSIYATLYMDTWRKDSVVML LHHVVTLILIVSSYAFRYHNVGILVLFLHDISDVQLEFTKLNIYFKSRGGSYHRLHALAA DLGCLSFGFSWFWFRLYWFPLKVLYATSHCSLRTVPDIPFYFFFNALLLLLTLMNLYWFL YIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Angiomotin Recombinant Rabbit monoclonal Antibody
HA722834 100 µL

Angiomotin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
P24-HIV (p24/661), CF647 conjugate, 0.1mg/mL
BNC470661-100 1x 100 µL

P24-HIV (p24/661), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GPR89C Human Gene Knockout Kit (CRISPR)
KN416530 1 Kit

GPR89C Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4'-Fluorovalerophenone
TRC-F171710-1G 1 g

4'-Fluorovalerophenone

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS631495 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Human Collagen alpha 1(XXVIII) chain (COL28A1) activation kit by CRISPRa
GA117468 1 Kit

Human Collagen alpha 1(XXVIII) chain (COL28A1) activation kit by CRISPRa

Sign In for Pricing
View Details