Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Transmembrane protein 19 (Tmem19)

This Recombinant Rat Transmembrane protein 19 (Tmem19) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Transmembrane protein 19

UniProt

Q6P726

Expression Region

1-351

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSIPSPQVLLALFSMTDLDDSTCKKYIKMITNIVILSLIICISLAFWIMSMTASTYYGS LRPVSPWRWLFSVVVSVVISCNGFKKKSLDHSGALGGLVVGFILTIANFSFFTSLLMFFL TSSKLTKWRGEMKKRLDSEYKEGGQRNWVQVFCNGGVPTELALLYMIENGPGEMPIDFAK QHTASWMCLSLLAALASSAGDTWASEVAPVLSKSSPRLITTWEKVPVGTNGGVTAVGLVS SLLGGTFVGLAYFLTQLVFVNDLDISAPQWPLIAFGGLAGLLGSIVDSFLGATMQFSGLD ESTGLVVSSPTQETKHISGKPILDNNAVNLFSSVLVALLLPTAASGFWPTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APR3 Rabbit Polyclonal Antibody
ER1803-44 100 µL

APR3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ELK1 pSer383 Rabbit Polyclonal Antibody
AP01577PU-N 100 µg

ELK1 pSer383 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Aquaporin 4 Recombinant Chimeric Antibody Antibody
HA610295 100 µg

Aquaporin 4 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Human CBX8 activation kit by CRISPRa
GA111465 1 Kit

Human CBX8 activation kit by CRISPRa

Sign In for Pricing
View Details
MEK1 (MAP2K1) pSer218/221 Rabbit Polyclonal Antibody
AP12640PU-N 400 µL

MEK1 (MAP2K1) pSer218/221 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DTX2 (NM_001102596) Human Over-expression Lysate
LY420165 100 µg

DTX2 (NM_001102596) Human Over-expression Lysate

Sign In for Pricing
View Details