Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Transmembrane protein 19 (Tmem19)

This Recombinant Rat Transmembrane protein 19 (Tmem19) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Transmembrane protein 19

UniProt

Q6P726

Expression Region

1-351

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSIPSPQVLLALFSMTDLDDSTCKKYIKMITNIVILSLIICISLAFWIMSMTASTYYGS LRPVSPWRWLFSVVVSVVISCNGFKKKSLDHSGALGGLVVGFILTIANFSFFTSLLMFFL TSSKLTKWRGEMKKRLDSEYKEGGQRNWVQVFCNGGVPTELALLYMIENGPGEMPIDFAK QHTASWMCLSLLAALASSAGDTWASEVAPVLSKSSPRLITTWEKVPVGTNGGVTAVGLVS SLLGGTFVGLAYFLTQLVFVNDLDISAPQWPLIAFGGLAGLLGSIVDSFLGATMQFSGLD ESTGLVVSSPTQETKHISGKPILDNNAVNLFSSVLVALLLPTAASGFWPTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MS4A5 rabbit pAb
RA30812-01 50 µL

MS4A5 rabbit pAb

Sign In for Pricing
View Details
MS4A5 rabbit pAb
RA30812-02 100 µL

MS4A5 rabbit pAb

Sign In for Pricing
View Details
Recombinant Hyphomonas neptunium UDP-N-acetylenolpyruvoylglucosamine reductase (murB)
MBS1439598-01 0.02 mg (E-Coli)

Recombinant Hyphomonas neptunium UDP-N-acetylenolpyruvoylglucosamine reductase (murB)

Sign In for Pricing
View Details
Recombinant Hyphomonas neptunium UDP-N-acetylenolpyruvoylglucosamine reductase (murB)
MBS1439598-02 0.02 mg (Yeast)

Recombinant Hyphomonas neptunium UDP-N-acetylenolpyruvoylglucosamine reductase (murB)

Sign In for Pricing
View Details
Recombinant Hyphomonas neptunium UDP-N-acetylenolpyruvoylglucosamine reductase (murB)
MBS1439598-03 0.1 mg (E-Coli)

Recombinant Hyphomonas neptunium UDP-N-acetylenolpyruvoylglucosamine reductase (murB)

Sign In for Pricing
View Details
Recombinant Hyphomonas neptunium UDP-N-acetylenolpyruvoylglucosamine reductase (murB)
MBS1439598-04 0.1 mg (Yeast)

Recombinant Hyphomonas neptunium UDP-N-acetylenolpyruvoylglucosamine reductase (murB)

Sign In for Pricing
View Details