Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbC (pcbC)

This Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbC (pcbC) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Divinyl chlorophyll a/b light-harvesting protein pcbC

UniProt

Q7VC57

Expression Region

1-351

Origin

Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Field of Research

Neuroscience; Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQTYGNPNVTYAWYAGNSGTTNRSGKFIAAHAAHAGLMMFWAGAFTLFELARYDSSIPMG NQNLICLPHLAGLGIGGVSNGVITEPYGCTVIAVLHLIFSGVLGAGGLLHSMRYEGDLGN YPEGSRAKKFDFEWDDPDRLTFILGHHLIFLGLGNIQFVEWARIHGIYDSAQGITRTVNY NLDLGMIWNHQADFLTINSLEDVMGGHAFLAFFLIIGGAFHIATKQYGQYTEFKGKGLLS AESVLSYSLAGVAYCAFVAAFWCATNTTIYPTDLYGEVLSLKFEFAPYFVDTADLPADAH TARAWLSNVHFYLGFFFLQGHLWHALRGMGFDFKRVGKAFDNMESAKITAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse MMS22L siRNA
abx924338-01 15 nmol

Mouse MMS22L siRNA

Sign In for Pricing
View Details
Mouse MMS22L siRNA
abx924338-02 30 nmol

Mouse MMS22L siRNA

Sign In for Pricing
View Details
Lambda Light Chain (AP) discontinued
L1185-15-AP 100 µL

Lambda Light Chain (AP) discontinued

Sign In for Pricing
View Details
GalR1 Antibody
ANT-35412-100ug 100 µg

GalR1 Antibody

Sign In for Pricing
View Details
Vmn1r152 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3086503 1.0 µg DNA

Vmn1r152 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Anti-TDRD3 Antibody Picoband®, iFluor647 Conjugate
A08978-iFluor647 100 µg

Anti-TDRD3 Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details