Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus subsp. pastoris Divinyl chlorophyll a/b light-harvesting protein pcbA (pcbA)

This Recombinant Prochlorococcus marinus subsp. pastoris Divinyl chlorophyll a/b light-harvesting protein pcbA (pcbA) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

Divinyl chlorophyll a/b light-harvesting protein pcbA

UniProt

O07295

Expression Region

1-352

Origin

Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQTYGNPDTTYGWWAGNSGVANRSGKFIAAHVAHAGLIVFWAGAFTLFELSRFDPSVPMG QQPLIALPHLATLGIGFDADGVLMGDTKPVLAIAIVHLVSSMVLAAGGLLHSLLLPGNLE ESEVAKARKFNIEWDNPDKLTFILGHHLIILGFAVILLVEWARVHGVYDPAIGAVRQVEY DLNLAEIWNHQTDFLLIDDLEDVMGGHAFLAFVLITGGAWHIATKQVGEYTKFKGKGLLS AEAVLSWSLAGIGWMAIIAAFWSASNTTVYPVEFFGEPLELKFSISPYWIDTVDLPDGVY TSRAWLANVHYYFGFFFIQGHLWHALRALGFDFKRVTNAISNIDSATVTLKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C17orf80 (NM_001100621) Human Tagged ORF Clone
RC221916 10 µg

C17orf80 (NM_001100621) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit CNTF (Ciliary Neurotrophic Factor) ELISA Kit
ERb22453 96 Tests

Rabbit CNTF (Ciliary Neurotrophic Factor) ELISA Kit

Sign In for Pricing
View Details
Iluoridine impurity 9
HY-Z0380-01 100 mg

Iluoridine impurity 9

Sign In for Pricing
View Details
Iluoridine impurity 9
HY-Z0380-02 250 mg

Iluoridine impurity 9

Sign In for Pricing
View Details
Iluoridine impurity 9
HY-Z0380-03 500 mg

Iluoridine impurity 9

Sign In for Pricing
View Details
Iluoridine impurity 9
HY-Z0380-04 1 g

Iluoridine impurity 9

Sign In for Pricing
View Details