Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus subsp. pastoris Divinyl chlorophyll a/b light-harvesting protein pcbA (pcbA)

This Recombinant Prochlorococcus marinus subsp. pastoris Divinyl chlorophyll a/b light-harvesting protein pcbA (pcbA) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

Divinyl chlorophyll a/b light-harvesting protein pcbA

UniProt

O07295

Expression Region

1-352

Origin

Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQTYGNPDTTYGWWAGNSGVANRSGKFIAAHVAHAGLIVFWAGAFTLFELSRFDPSVPMG QQPLIALPHLATLGIGFDADGVLMGDTKPVLAIAIVHLVSSMVLAAGGLLHSLLLPGNLE ESEVAKARKFNIEWDNPDKLTFILGHHLIILGFAVILLVEWARVHGVYDPAIGAVRQVEY DLNLAEIWNHQTDFLLIDDLEDVMGGHAFLAFVLITGGAWHIATKQVGEYTKFKGKGLLS AEAVLSWSLAGIGWMAIIAAFWSASNTTVYPVEFFGEPLELKFSISPYWIDTVDLPDGVY TSRAWLANVHYYFGFFFIQGHLWHALRALGFDFKRVTNAISNIDSATVTLKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4,5-Dihydro-4,4-dimethyl-2- (3-pyridyl) oxazole
orb3031520-01 200 mg

4,5-Dihydro-4,4-dimethyl-2- (3-pyridyl) oxazole

Sign In for Pricing
View Details
4,5-Dihydro-4,4-dimethyl-2- (3-pyridyl) oxazole
orb3031520-02 10 mg

4,5-Dihydro-4,4-dimethyl-2- (3-pyridyl) oxazole

Sign In for Pricing
View Details
4,5-Dihydro-4,4-dimethyl-2- (3-pyridyl) oxazole
orb3031520-03 50 mg

4,5-Dihydro-4,4-dimethyl-2- (3-pyridyl) oxazole

Sign In for Pricing
View Details
ALDH5A1, NT (ALDH5A1, SSADH, Succinate-semialdehyde dehydrogenase, mitochondrial, Aldehyde dehydrogenase family 5 member A1, NAD (+) -dependent succinic semialdehyde dehydrogenase) (MaxLight 405) discontinued
031776-ML405 100 µL

ALDH5A1, NT (ALDH5A1, SSADH, Succinate-semialdehyde dehydrogenase, mitochondrial, Aldehyde dehydrogenase family 5 member A1, NAD (+) -dependent succinic semialdehyde dehydrogenase) (MaxLight 405) discontinued

Sign In for Pricing
View Details
PLEKHF1 (N-term) Rabbit Polyclonal Antibody
E10G33764 100 µL

PLEKHF1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-UQCRC2 Antibody, Rabbit Polyclonal
MBS8108389-01 0.1 mL

Anti-UQCRC2 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details