Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus subsp. pastoris Divinyl chlorophyll a/b light-harvesting protein pcbA (pcbA)

This Recombinant Prochlorococcus marinus subsp. pastoris Divinyl chlorophyll a/b light-harvesting protein pcbA (pcbA) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

Divinyl chlorophyll a/b light-harvesting protein pcbA

UniProt

O07295

Expression Region

1-352

Origin

Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQTYGNPDTTYGWWAGNSGVANRSGKFIAAHVAHAGLIVFWAGAFTLFELSRFDPSVPMG QQPLIALPHLATLGIGFDADGVLMGDTKPVLAIAIVHLVSSMVLAAGGLLHSLLLPGNLE ESEVAKARKFNIEWDNPDKLTFILGHHLIILGFAVILLVEWARVHGVYDPAIGAVRQVEY DLNLAEIWNHQTDFLLIDDLEDVMGGHAFLAFVLITGGAWHIATKQVGEYTKFKGKGLLS AEAVLSWSLAGIGWMAIIAAFWSASNTTVYPVEFFGEPLELKFSISPYWIDTVDLPDGVY TSRAWLANVHYYFGFFFIQGHLWHALRALGFDFKRVTNAISNIDSATVTLKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TATA-Box Binding Protein Associated Factor, RNA Polymerase I Subunit B (TAF1B) Antibody
abx122478-01 100 µg

TATA-Box Binding Protein Associated Factor, RNA Polymerase I Subunit B (TAF1B) Antibody

Sign In for Pricing
View Details
TATA-Box Binding Protein Associated Factor, RNA Polymerase I Subunit B (TAF1B) Antibody
abx122478-02 1 mg

TATA-Box Binding Protein Associated Factor, RNA Polymerase I Subunit B (TAF1B) Antibody

Sign In for Pricing
View Details
pH 3.5 Monobasic Na Phosphate acc USP - 500ML
USP8405 500 mL

pH 3.5 Monobasic Na Phosphate acc USP - 500ML

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Fibroblast Growth Factor 21 (FGF21)
MBS2068972-01 0.1 mL

HRP-Linked Polyclonal Antibody to Fibroblast Growth Factor 21 (FGF21)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Fibroblast Growth Factor 21 (FGF21)
MBS2068972-02 0.2 mL

HRP-Linked Polyclonal Antibody to Fibroblast Growth Factor 21 (FGF21)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Fibroblast Growth Factor 21 (FGF21)
MBS2068972-03 0.5 mL

HRP-Linked Polyclonal Antibody to Fibroblast Growth Factor 21 (FGF21)

Sign In for Pricing
View Details