Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbH (pcbH)

This Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbH (pcbH) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

Divinyl chlorophyll a/b light-harvesting protein pcbH

UniProt

Q7VBC2

Expression Region

1-352

Origin

Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQTYGNPDVTYGWWVGNSVVTNRAGRFIGSHVGHTGIICFATGASCLWELSRFDSSVPMG HQSSIYLSHLASLGIGFDEAGVWTGAGVATIAIFHLIFSMVYGGAGLAHSLFFDPDLNEG PIGRVDKFKLEWDNPNNLTFILGHHLIFLGVANIWFVEWARVHGIYDPALGEVRTIFPGY GDFGMVWGHQFDFIKIDSLEDVMSGHAFLAFLQISGGAFHIATRQIGEYTKFKGDGLLSA EAVLSWSLAGLFLMGVVAAFWAASNTTVYPTEWYGEPLEFKFGISPYWADTGDTSDCKYF FGHTSRAALVNVQYYFAFFCLQGHLWHALRALGFDFRRIAKAIGGLTESTSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C9orf150 Protein Vector (Human) (pPM-C-HA)
PV006987 500 ng

C9orf150 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Caspase-1 (CASP1) Antibody
abx455085-01 50 µg

Caspase-1 (CASP1) Antibody

Sign In for Pricing
View Details
Caspase-1 (CASP1) Antibody
abx455085-02 100 µg

Caspase-1 (CASP1) Antibody

Sign In for Pricing
View Details
AMPD2 (NM_001257360) Human Tagged ORF Clone
RG234989 10 µg

AMPD2 (NM_001257360) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Corynebacterium kroppenstedtii D-inositol 3-phosphate glycosyltransferase (mshA)
MBS1051604-01 0.02 mg (E-Coli)

Recombinant Corynebacterium kroppenstedtii D-inositol 3-phosphate glycosyltransferase (mshA)

Sign In for Pricing
View Details
Recombinant Corynebacterium kroppenstedtii D-inositol 3-phosphate glycosyltransferase (mshA)
MBS1051604-02 0.02 mg (Yeast)

Recombinant Corynebacterium kroppenstedtii D-inositol 3-phosphate glycosyltransferase (mshA)

Sign In for Pricing
View Details