Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbH (pcbH)

This Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbH (pcbH) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

Divinyl chlorophyll a/b light-harvesting protein pcbH

UniProt

Q7VBC2

Expression Region

1-352

Origin

Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQTYGNPDVTYGWWVGNSVVTNRAGRFIGSHVGHTGIICFATGASCLWELSRFDSSVPMG HQSSIYLSHLASLGIGFDEAGVWTGAGVATIAIFHLIFSMVYGGAGLAHSLFFDPDLNEG PIGRVDKFKLEWDNPNNLTFILGHHLIFLGVANIWFVEWARVHGIYDPALGEVRTIFPGY GDFGMVWGHQFDFIKIDSLEDVMSGHAFLAFLQISGGAFHIATRQIGEYTKFKGDGLLSA EAVLSWSLAGLFLMGVVAAFWAASNTTVYPTEWYGEPLEFKFGISPYWADTGDTSDCKYF FGHTSRAALVNVQYYFAFFCLQGHLWHALRALGFDFRRIAKAIGGLTESTSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pLL-CMV-RFP-T2A-Blast [Lenti-LabelerTM plasmid]
LL115PA-1 10 µg

pLL-CMV-RFP-T2A-Blast [Lenti-LabelerTM plasmid]

Sign In for Pricing
View Details
Human IL-6 ELISA Kit
RK00004 96 Tests

Human IL-6 ELISA Kit

Sign In for Pricing
View Details
Mouse CD177 Antigen / NB1 (CD177) ELISA Kit
abx517603-01 96 Tests

Mouse CD177 Antigen / NB1 (CD177) ELISA Kit

Sign In for Pricing
View Details
Mouse CD177 Antigen / NB1 (CD177) ELISA Kit
abx517603-02 5x 96 Tests

Mouse CD177 Antigen / NB1 (CD177) ELISA Kit

Sign In for Pricing
View Details
Mouse CD177 Antigen / NB1 (CD177) ELISA Kit
abx517603-03 10x 96 Tests

Mouse CD177 Antigen / NB1 (CD177) ELISA Kit

Sign In for Pricing
View Details
FCGR1A Antibody
orb1731981 100 µL

FCGR1A Antibody

Sign In for Pricing
View Details