Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbH (pcbH)

This Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbH (pcbH) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

Divinyl chlorophyll a/b light-harvesting protein pcbH

UniProt

Q7VBC2

Expression Region

1-352

Origin

Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQTYGNPDVTYGWWVGNSVVTNRAGRFIGSHVGHTGIICFATGASCLWELSRFDSSVPMG HQSSIYLSHLASLGIGFDEAGVWTGAGVATIAIFHLIFSMVYGGAGLAHSLFFDPDLNEG PIGRVDKFKLEWDNPNNLTFILGHHLIFLGVANIWFVEWARVHGIYDPALGEVRTIFPGY GDFGMVWGHQFDFIKIDSLEDVMSGHAFLAFLQISGGAFHIATRQIGEYTKFKGDGLLSA EAVLSWSLAGLFLMGVVAAFWAASNTTVYPTEWYGEPLEFKFGISPYWADTGDTSDCKYF FGHTSRAALVNVQYYFAFFCLQGHLWHALRALGFDFRRIAKAIGGLTESTSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gnb5 (NM_138719) Mouse Tagged ORF Clone Lentiviral Particle
MR222705L4V 200 µL

Gnb5 (NM_138719) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
NAA11 Protein Vector (Rat) (pPB-N-His)
PV284187 500 ng

NAA11 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
A430005L14Rik Protein Vector (Mouse) (pPB-N-His)
PV150655 500 ng

A430005L14Rik Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Sphingosine-1-phosphate Receptor 1 (S1PR1) ACTOne Stable Cell Line
MBS433663 Inquire

Sphingosine-1-phosphate Receptor 1 (S1PR1) ACTOne Stable Cell Line

Sign In for Pricing
View Details
MTHFD2L Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
30889064 1.0 µg DNA

MTHFD2L Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Recombinant Anabaena variabilis DNA-directed RNA polymerase subunit gamma (rpoC1), partial
MBS1285063 Inquire

Recombinant Anabaena variabilis DNA-directed RNA polymerase subunit gamma (rpoC1), partial

Sign In for Pricing
View Details