Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oryza sativa subsp. indica Probable polyprenol reductase 2 (OsI_26070)

This Recombinant Oryza sativa subsp. indica Probable polyprenol reductase 2 (OsI_26070) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Probable polyprenol reductase 2, EC= 1.3.1.-

UniProt

B8B6G5

Expression Region

1-353

Origin

Oryza sativa subsp. indica (Rice)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESEGWPALQPLLCFAWIAATLPIIAAALPIPTAVGGHLLRRLLSAFSSRGKTVRPSPAS SSGSSSSKAKFTVPQKYFMHFYVVGVLATTILLLAIWFYAYMKLTPLLLESSSYSTIFSH LVGSNSFSFGRVRSRTMGHKYRVWRTVFALLLMEVQVLRRLYETEHVFHYSPARMHIVGY LTGLFYYVAAPLSLASSCIPEAAEYFQGQVPEFVVKGRARMPDLVIDSSSLLQPLLKLGW TQWIGAVIFIWGSLHQIRCHAILGSLREHKDSDEYVIPCSDCFNRVSCPHYLAELVIYFG MLVASGAEDIPVWFLFIFLITNLSFAAVETYNWYLQKFEDYPRSRYAIIPFVC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL
BNC551050-500 1x 500 µL

CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL
BNC681073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF740 conjugate, 0.1mg/mL
BNC740253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF568 conjugate, 0.1mg/mL
BNC680039-500 1x 500 µL

CD34 (ICO-115), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1718), CF647 conjugate, 0.1mg/mL
BNC471718-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1718), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL
BNC400257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details