Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbF (pcbF)

This Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbF (pcbF) spans the amino acid sequence from region 1-354.

Product Specifications

Product Name Alternative

Divinyl chlorophyll a/b light-harvesting protein pcbF

UniProt

Q9L8M1

Expression Region

1-354

Origin

Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQTYGNPDVTYDYWAGNASVTNRSGRFIASHAAHTGMIAFGAGSNTLFELSRFDSSLPMG DQGFVFLPHLASVGIGFDEAGVWTGAGVVTLAILHLILSMVYGAGGLLHAIYFPDDMQKS NVPQARKFKLEWDNPDNQTFILGHHLILFGLACAWFVEWARIHGIYDPAIGAVRQVNYNL DLSMIWERQVNFLNIDSLEDVMGGHAFLAFAEITGGCFHAIAGSTKWEDKRLGEYDRLKG AGLLSAEAILSFSLAGIGWMAIVAAFWCSQNTTVYPIEFYGEPLNRAFVIAPAFVDSIDY SNGIAPLGHSGRCYTANFHYIAGFFAFQGHLWHALRAMGYNFKDLRAKLNPSAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS632425 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
MSK1 (Ab-581) Antibody
8B0686-AAT 50 µg

MSK1 (Ab-581) Antibody

Sign In for Pricing
View Details
o-Cresol Beta-D-Glucuronide
TRC-C782000-5MG 5 mg

o-Cresol Beta-D-Glucuronide

Sign In for Pricing
View Details
4,4'-Oxydibenzenesulfonyl Hydrazide
TRC-O870638-1G 1 g

4,4'-Oxydibenzenesulfonyl Hydrazide

Sign In for Pricing
View Details
Ier3ip1 (NM_025409) Mouse Tagged ORF Clone
MG200156 10 µg

Ier3ip1 (NM_025409) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Tissue Total RNA, Endometrium
CR562737 5 µg

Tissue Total RNA, Endometrium

Sign In for Pricing
View Details