Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbF (pcbF)

This Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbF (pcbF) spans the amino acid sequence from region 1-354.

Product Specifications

Product Name Alternative

Divinyl chlorophyll a/b light-harvesting protein pcbF

UniProt

Q9L8M1

Expression Region

1-354

Origin

Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQTYGNPDVTYDYWAGNASVTNRSGRFIASHAAHTGMIAFGAGSNTLFELSRFDSSLPMG DQGFVFLPHLASVGIGFDEAGVWTGAGVVTLAILHLILSMVYGAGGLLHAIYFPDDMQKS NVPQARKFKLEWDNPDNQTFILGHHLILFGLACAWFVEWARIHGIYDPAIGAVRQVNYNL DLSMIWERQVNFLNIDSLEDVMGGHAFLAFAEITGGCFHAIAGSTKWEDKRLGEYDRLKG AGLLSAEAILSFSLAGIGWMAIVAAFWCSQNTTVYPIEFYGEPLNRAFVIAPAFVDSIDY SNGIAPLGHSGRCYTANFHYIAGFFAFQGHLWHALRAMGYNFKDLRAKLNPSAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RSK3 (RPS6KA2) (NM_021135) Human Over-expression Lysate
LY402841 100 µg

RSK3 (RPS6KA2) (NM_021135) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Soft tissue
CS714357 5x 5 µm

Tissue FFPE Sections, Soft tissue

Sign In for Pricing
View Details
Ammonium Ferric Disulfate Dodecahydrate
TRC-A634113-5G 5 g

Ammonium Ferric Disulfate Dodecahydrate

Sign In for Pricing
View Details
Purified Anti-Mouse CD106 Antibody[M/K-2.7]
E-AB-F1091A-01 25 µg

Purified Anti-Mouse CD106 Antibody[M/K-2.7]

Sign In for Pricing
View Details
Purified Anti-Mouse CD106 Antibody[M/K-2.7]
E-AB-F1091A-02 100 µg

Purified Anti-Mouse CD106 Antibody[M/K-2.7]

Sign In for Pricing
View Details
Calcein AM, 20x50 ug
#80011-3 20x 50 µg

Calcein AM, 20x50 ug

Sign In for Pricing
View Details