Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbF (pcbF)

This Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbF (pcbF) spans the amino acid sequence from region 1-354.

Product Specifications

Product Name Alternative

Divinyl chlorophyll a/b light-harvesting protein pcbF

UniProt

Q9L8M1

Expression Region

1-354

Origin

Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQTYGNPDVTYDYWAGNASVTNRSGRFIASHAAHTGMIAFGAGSNTLFELSRFDSSLPMG DQGFVFLPHLASVGIGFDEAGVWTGAGVVTLAILHLILSMVYGAGGLLHAIYFPDDMQKS NVPQARKFKLEWDNPDNQTFILGHHLILFGLACAWFVEWARIHGIYDPAIGAVRQVNYNL DLSMIWERQVNFLNIDSLEDVMGGHAFLAFAEITGGCFHAIAGSTKWEDKRLGEYDRLKG AGLLSAEAILSFSLAGIGWMAIVAAFWCSQNTTVYPIEFYGEPLNRAFVIAPAFVDSIDY SNGIAPLGHSGRCYTANFHYIAGFFAFQGHLWHALRAMGYNFKDLRAKLNPSAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phenyl 4-Bromo-2-cyclopropylpyridine-1(2H)-carboxylate
TRC-P336720-50MG 50 mg

Phenyl 4-Bromo-2-cyclopropylpyridine-1(2H)-carboxylate

Sign In for Pricing
View Details
Tissue FFPE Sections, Cecum
CS706235 5x 5 µm

Tissue FFPE Sections, Cecum

Sign In for Pricing
View Details
AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2491), CF640R conjugate, 0.1mg/mL
BNC402491-500 1x 500 µL

AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2491), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4-ethylphenyl isocyanide
TRC-B438213-500MG 500 mg

4-ethylphenyl isocyanide

Sign In for Pricing
View Details
Dechlorane 604 Component A
TRC-D226210-50MG 50 mg

Dechlorane 604 Component A

Sign In for Pricing
View Details
Human SHROOM4 activation kit by CRISPRa
GA111522 1 Kit

Human SHROOM4 activation kit by CRISPRa

Sign In for Pricing
View Details