Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aquifex aeolicus Uncharacterized protein aq_359 (aq_359)

This Recombinant Aquifex aeolicus Uncharacterized protein aq_359 (aq_359) spans the amino acid sequence from region 1-356.

Product Specifications

Product Name Alternative

Uncharacterized protein aq_359

UniProt

O66685

Expression Region

1-356

Origin

Aquifex aeolicus (strain VF5)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLDRYLLSRFLGIFLNVSFVSVLLVSLYALLDFLVGFKEKRTDVALSYFLNILPLGFYY ISFITLSISLILFLRKVFEKKMELTVQSFGISPLRFSLPVLLFSVFLSSTFLLGNEYAFP KLLGNLWFIEKNYKKKQEVKGFIKNFWFIKKENEVKTYYHVGNLNLSDGSLFNFYTMKVE RKNLNPLEVLKVFSGVWKDKEIFIRSGEIYDFEKGKREKVFNKTFKLGLSIKEVELFSEK IDFLSLSEIFFLMQKSKKVGLNVDVYTGELFYRVMFSLSPVFISIFSLYLFFKHKVLSQV IPRFLVFIVILWLVILSPKILPQKANQPVLYSLIPIFLLILYSLKGVYDLRKGFRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD16 (C16/1045), CF568 conjugate, 0.1mg/mL
BNC681045-500 1x 500 µL

CD16 (C16/1045), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL
BNC880096-500 1x 500 µL

Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL
BNC940034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL
BNC040253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL
BNC471037-100 1x 100 µL

CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF594 conjugate, 0.1mg/mL
BNC940160-100 1x 100 µL

CD20 (B9E9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details