Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Uncharacterized membrane protein SSP1970 (SSP1970)

This Recombinant Staphylococcus saprophyticus subsp. saprophyticus Uncharacterized membrane protein SSP1970 (SSP1970) spans the amino acid sequence from region 1-356.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein SSP1970

UniProt

Q49VU5

Expression Region

1-356

Origin

Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFEAIIYNISVTVAGIYLFHRLQYSENRIMVFSKEYVTVLMTIVALLLSAYPVPIFNEYT LYLSFVPILFLGRYTNMFYTVLSAFIVGLVNVLIGDYTIITAMIFIVIAGIIGAIGPFLK QSDIISLQILNVIALVIFAILSLISPYYEITEVLFLIPISFVLTITSSITFVDIWHFFSL VNRYENEDKVDYLTGLGNVKEFDRHLNETARLSEENNQSLGLLLIDIDGFKDVNDMYSHK SGDAVLRQVAQLLKNYVPQQFSIYRNGGEEFSIVLYDYTLDQCVKLSESIRGGVEQSTFH LPNKEVIKLSVSIGVGYLTTDDYKSQRKVFKIADDMLHMAKNEGRNQVMFNPIVKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ubiquitin Specific Peptidase 46 Protein
abx263408-01 2 µg

Ubiquitin Specific Peptidase 46 Protein

Sign In for Pricing
View Details
Ubiquitin Specific Peptidase 46 Protein
abx263408-02 10 µg

Ubiquitin Specific Peptidase 46 Protein

Sign In for Pricing
View Details
Ubiquitin Specific Peptidase 46 Protein
abx263408-03 100 µg

Ubiquitin Specific Peptidase 46 Protein

Sign In for Pricing
View Details
CTNND2 Antibody, Biotin conjugated
CSB-PA892496LD01HU-01 50 µg

CTNND2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
CTNND2 Antibody, Biotin conjugated
CSB-PA892496LD01HU-02 100 µg

CTNND2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
RGD1307752 (NM_001013922) Rat Tagged ORF Clone Lentiviral Particle
RR202376L3V 200 µL

RGD1307752 (NM_001013922) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details