Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Uncharacterized membrane protein SACOL0809 (SACOL0809)

This Recombinant Staphylococcus aureus Uncharacterized membrane protein SACOL0809 (SACOL0809) spans the amino acid sequence from region 1-356.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein SACOL0809

UniProt

Q5HHS4

Expression Region

1-356

Origin

Staphylococcus aureus (strain COL)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFEAFIYNISVIVAGIYLFHRLQYSENKRMVFSKAYVTVLMTIVSLLLSVYPIPYREDYL IHLTFVPLLFLGRFTNMVYTLSATVIVAIVEIVVFNNSIMYGVTLIVIAAVTSAIGPFLK QNDVLSLLILNVVTIIILFGVALVSPIYTLSEVIILIPISLIITLASAITFVDIWHFFSL VNRYENEDKYDYLTGLGNVKEFDRHLNEISRKAEKEHQSIALLLIDIDGFKDVNDTYSHK SGDAVLKQMSQLLKNYVPNQFKIFRNGGEEFSVVIHNYSLDQSVKLAENIRSGVEKSSFH LPNKEVIKLSVSIGVGYLTDDDPKSQRKVFKDADDMVHVAKNQGRNKVMFNPIINL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL-1α (Interleukin 1 Alpha) ELISA Kit
E-EL-H0088-01 24 Tests

Human IL-1α (Interleukin 1 Alpha) ELISA Kit

Sign In for Pricing
View Details
Human IL-1α (Interleukin 1 Alpha) ELISA Kit
E-EL-H0088-02 48 Tests

Human IL-1α (Interleukin 1 Alpha) ELISA Kit

Sign In for Pricing
View Details
Human IL-1α (Interleukin 1 Alpha) ELISA Kit
E-EL-H0088-03 96 Tests

Human IL-1α (Interleukin 1 Alpha) ELISA Kit

Sign In for Pricing
View Details
JNK1 (MAPK8) (+JNK2/3) Rabbit Polyclonal Antibody
AP20729PU-N 100 µg

JNK1 (MAPK8) (+JNK2/3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human PRPF38A activation kit by CRISPRa
GA113793 1 Kit

Human PRPF38A activation kit by CRISPRa

Sign In for Pricing
View Details
Tricyclohexyl Phosphine (90%)
TRC-T774600-5G 5 g

Tricyclohexyl Phosphine (90%)

Sign In for Pricing
View Details