Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Uncharacterized membrane protein SAS0711 (SAS0711)

This Recombinant Staphylococcus aureus Uncharacterized membrane protein SAS0711 (SAS0711) spans the amino acid sequence from region 1-356.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein SAS0711

UniProt

Q6GB84

Expression Region

1-356

Origin

Staphylococcus aureus (strain MSSA476)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFEAFIYNISVIVAGIYLFHRLQYSENKRMVFSKAYVTVLMTIVSLLLSVYPIPYREDYL IHLTFVPLLFLGRFTNMVYTLSATVIVAIVEIVVFNNSIMYGVTLIVIAAVTSAIGPFLK QNDVLSLLILNVVTIIILFGVALVSPIYTLSEVIILIPISLIITLASAITFVDIWHFFSL VNRYENEDKYDYLTGLGNVKEFDRHLNEISRKAEKEHQSIALLLIDIDGFKDVNDTYSHK SGDAVLKQMSQLLKNYVPNQFKIFRNGGEEFSVVIHNYSLDQSVKLAENIRSGVEKSSFH LPNKEVIKLSVSIGVGYLTDDDPKSQRKVFKDADDMVHVAKNQGRNKVMFNPIINL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc22a23 Mouse Gene Knockout Kit (CRISPR)
KN515934 1 Kit

Slc22a23 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IBRDC2 (RNF144B) activation kit by CRISPRa
GA116827 1 Kit

Human IBRDC2 (RNF144B) activation kit by CRISPRa

Sign In for Pricing
View Details
RASAL1 Rabbit Polyclonal Antibody
TA380725 100 µL

RASAL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
APC Anti-Mouse CD80 Antibody
RD30105F-01 25 µg

APC Anti-Mouse CD80 Antibody

Sign In for Pricing
View Details
APC Anti-Mouse CD80 Antibody
RD30105F-02 100 µg

APC Anti-Mouse CD80 Antibody

Sign In for Pricing
View Details
SFRS7 Antibody
8C18943-AAT 50 µg

SFRS7 Antibody

Sign In for Pricing
View Details