Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein in llm 5'region

This Recombinant Uncharacterized membrane protein in llm 5'region spans the amino acid sequence from region 1-356.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein in llm 5'region, ORF1

UniProt

Q7DLB7

Expression Region

1-356

Origin

Staphylococcus aureus

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFEAFIYNISVIVAGIYLFHRLQYSENKRMVFSKAYVTVLMTIVSLLLSVYPIPYREDYL IHLTFVPLLFLGRFTNMVYTLSATVIVAIVEIVVFNNSIMYGVTLIVIAAVTSAIGPFLK QNDVLSLLILNVVTIIILFGVALVSPIYTLSEVIILIPISLIITLASAITFVDIWHFFSL VNRYENEDKYDYLTGLGNVKEFDRHLNEISRKAEKEHQSIALLLIDIDGFKDVNDTYSHK SGDAVLKQMSQLLKNYVPNQFKIFRNGGEEFSVVIHNYSLDQSVKLAENIRSGVEKSSFH LPNKEVIKLSVSIGVGYLTDDDPKSQRKVFKDADDMVHVAKNQGRNKVMFNPIINL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (34BE12), CF568 conjugate, 0.1mg/mL
BNC680446-500 1x 500 µL

Cytokeratin, HMW (34BE12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HENMT1 (NM_001102592) Human Recombinant Protein
TP312823M 100 µg

HENMT1 (NM_001102592) Human Recombinant Protein

Sign In for Pricing
View Details
GBP6 Antibody
KC-1656-01 50 μL

GBP6 Antibody

Sign In for Pricing
View Details
GBP6 Antibody
KC-1656-02 100 µL

GBP6 Antibody

Sign In for Pricing
View Details
GBP6 Antibody
KC-1656-03 1 mL

GBP6 Antibody

Sign In for Pricing
View Details
Whrn Mouse Gene Knockout Kit (CRISPR)
KN519427 1 Kit

Whrn Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details