Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Uncharacterized membrane protein MW0708 (MW0708)

This Recombinant Staphylococcus aureus Uncharacterized membrane protein MW0708 (MW0708) spans the amino acid sequence from region 1-356.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein MW0708

UniProt

Q7A1G8

Expression Region

1-356

Origin

Staphylococcus aureus (strain MW2)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFEAFIYNISVIVAGIYLFHRLQYSENKRMVFSKAYVTVLMTIVSLLLSVYPIPYREDYL IHLTFVPLLFLGRFTNMVYTLSATVIVAIVEIVVFNNSIMYGVTLIVIAAVTSAIGPFLK QNDVLSLLILNVVTIIILFGVALVSPIYTLSEVIILIPISLIITLASAITFVDIWHFFSL VNRYENEDKYDYLTGLGNVKEFDRHLNEISRKAEKEHQSIALLLIDIDGFKDVNDTYSHK SGDAVLKQMSQLLKNYVPNQFKIFRNGGEEFSVVIHNYSLDQSVKLAENIRSGVEKSSFH LPNKEVIKLSVSIGVGYLTDDDPKSQRKVFKDADDMVHVAKNQGRNKVMFNPIINL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

7-Aminocephalosporanic Acid
TRC-A603415-50G 50 g

7-Aminocephalosporanic Acid

Sign In for Pricing
View Details
Histone H3 (Citrulline Arg2, 8, 17) Mouse Monoclonal Antibody [Clone ID: 7C10]
AM10179PU-N 100 µg

Histone H3 (Citrulline Arg2, 8, 17) Mouse Monoclonal Antibody [Clone ID: 7C10]

Sign In for Pricing
View Details
ROR-gamma / RORC (RAR-related Orphan Receptor C) (RORC/2942), CF647 conjugate, 0.1mg/mL
BNC472942-100 1x 100 µL

ROR-gamma / RORC (RAR-related Orphan Receptor C) (RORC/2942), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse XCL1/Lymphotactin Protein (Trx Tag)
PDEM100175-01 20 µg

Recombinant Mouse XCL1/Lymphotactin Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse XCL1/Lymphotactin Protein (Trx Tag)
PDEM100175-02 100 µg

Recombinant Mouse XCL1/Lymphotactin Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse XCL1/Lymphotactin Protein (Trx Tag)
PDEM100175-03 500 µg

Recombinant Mouse XCL1/Lymphotactin Protein (Trx Tag)

Sign In for Pricing
View Details