Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Uncharacterized membrane protein SE_0528 (SE_0528)

This Recombinant Staphylococcus epidermidis Uncharacterized membrane protein SE_0528 (SE_0528) spans the amino acid sequence from region 1-356.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein SE_0528

UniProt

Q8CTF5

Expression Region

1-356

Origin

Staphylococcus epidermidis (strain ATCC 12228)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFEAIIYNISVMVAGIYLFHRLQYSENKRMIFSKEYVTVLMTFVSLLLAAYPIPFQNEYL VHLTFVPLLFLGRYTNMIYTLTAAFIVSLVDVFIFGNSIIYGITLIVIAGIVSAVGPFLK QNDIISLLILNLISIIILLFLALLSPIYELVEILVLIPISFIITIASAITFVDIWHFFSL VNRYENEDKYDYLTGLGNVKEFDRHLNEVSSKAEEKKQSLALLLIDIDGFKDVNDHYSHQ SGDAVLKQMSQLLKNYVPNQFKIFRNGGEEFSVVIRDYTLDQSVKLAENIRSGVEKSSFH LPNKEVIKLSVSIGVGYLTQEDRKSQRKVFKDADDMVHVAKSEGRNKVMFNPIVKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCMV-SPORT6-Fmo1 Plasmid
PVT43170 2 µg

pCMV-SPORT6-Fmo1 Plasmid

Sign In for Pricing
View Details
FAM98A Human siRNA Oligo Duplex (Locus ID 25940)
SR308612 1 Kit

FAM98A Human siRNA Oligo Duplex (Locus ID 25940)

Sign In for Pricing
View Details
CHODL Rabbit Polyclonal Antibody
TA374756 100 µL

CHODL Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti Retinoblastoma (RB) (901-928) Human Serum (50 ul)
NAY-8280-V 50 μL

Anti Retinoblastoma (RB) (901-928) Human Serum (50 ul)

Sign In for Pricing
View Details
Human Interleukin 20 (IL20) ELISA Kit
RD-IL20-Hu-01 96 Tests

Human Interleukin 20 (IL20) ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 20 (IL20) ELISA Kit
RD-IL20-Hu-02 48 Tests

Human Interleukin 20 (IL20) ELISA Kit

Sign In for Pricing
View Details