Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Uncharacterized membrane protein SE_0528 (SE_0528)

This Recombinant Staphylococcus epidermidis Uncharacterized membrane protein SE_0528 (SE_0528) spans the amino acid sequence from region 1-356.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein SE_0528

UniProt

Q8CTF5

Expression Region

1-356

Origin

Staphylococcus epidermidis (strain ATCC 12228)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFEAIIYNISVMVAGIYLFHRLQYSENKRMIFSKEYVTVLMTFVSLLLAAYPIPFQNEYL VHLTFVPLLFLGRYTNMIYTLTAAFIVSLVDVFIFGNSIIYGITLIVIAGIVSAVGPFLK QNDIISLLILNLISIIILLFLALLSPIYELVEILVLIPISFIITIASAITFVDIWHFFSL VNRYENEDKYDYLTGLGNVKEFDRHLNEVSSKAEEKKQSLALLLIDIDGFKDVNDHYSHQ SGDAVLKQMSQLLKNYVPNQFKIFRNGGEEFSVVIRDYTLDQSVKLAENIRSGVEKSSFH LPNKEVIKLSVSIGVGYLTQEDRKSQRKVFKDADDMVHVAKSEGRNKVMFNPIVKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse islet cell antibody, ICA ELISA Kit
CK-bio-16480-01 48 Tests

Mouse islet cell antibody, ICA ELISA Kit

Sign In for Pricing
View Details
Mouse islet cell antibody, ICA ELISA Kit
CK-bio-16480-02 96 Tests

Mouse islet cell antibody, ICA ELISA Kit

Sign In for Pricing
View Details
Mouse islet cell antibody, ICA ELISA Kit
CK-bio-16480-03 5x 96 Tests

Mouse islet cell antibody, ICA ELISA Kit

Sign In for Pricing
View Details
Mouse islet cell antibody, ICA ELISA Kit
CK-bio-16480-04 10x 96 Tests

Mouse islet cell antibody, ICA ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Gm5431 shRNA (UAS) - Lentiviral mouse Gm5431 shRNA (UAS, RFP) (25)
GTR15176819 1 Vial

Lentiviral mouse Gm5431 shRNA (UAS) - Lentiviral mouse Gm5431 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
IgG1 Polyclonal Antibody
MBS8523274-01 0.1 mg

IgG1 Polyclonal Antibody

Sign In for Pricing
View Details